Conserved Protein Domain Family
PTZ00351

?
PTZ00351: PTZ00351 
adenylosuccinate synthetase; Provisional
Statistics
?
PSSM-Id: 173544
View PSSM: PTZ00351
Aligned: 3 rows
Threshold Bit Score: 1429.83
Threshold Setting Gi: 157866314
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146080968   1 MPVRRYGGRYNNSSPGVSNALSPSTTAGRPLSPSPAAGSKLASTHHDPVPQEAYYVNDEADAWHQQQAPFREPSVEVEVE 80 
154333968   1 MPVRRYGGRYNNSSSGVSNALSSSSTAGLRPSPSSRENSTPLSTHHDPAFLSTNHAKNEGGLCQKHHVRFREPSVEVEVE 80 
157866314   1 MPVRRYGGRYNSSSPGVSNALNPSRTAGWPLSPSPATGSKPASTHHDPVPQEAYYVKDEADARHQQQAPLREPSVEVEVE 80 
146080968  81 MIDDEPPHGSQKSLSVAPYTANASSSSGRSKRNAITASGYTFYTNERQKTVYEALRSLRPLAELQEPRRVKEYAETSLKD 160
154333968  81 IMDDEPSRGLQKPPSRARHAADANNNSASAQCNTTRTSDYTFYTNEDQKKVYEALRSLRPLPELQEPRRVKEYSEVSIKE 160
157866314  81 IIDDEPPRGSQKPLSVAPCTANANNSSGGSKCNAITASRYTFYTNAYQKSVYEALRSLRPLPELQEPRRVKEYAETSLKD 160
146080968 161 SLYRIIEAHDVIMVAGAFFGDEGKGKTVDAVAHHPLCTCIARVNSGENAGHTVYDKAGRKFVFNLAPSGLLLPGKRNYIG 240
154333968 161 SLYRIVEAHDVIMVAGAFFGDEGKGKTVDAVAHHPLCTCIARVNSGENAGHTVYDKAGRKFVFNLAPSGLLLPGKRNYIG 240
157866314 161 SLYRIVEAHDVIMVAGAFFGDEGKGKTVDAVARHPLCTCIARVNSGENAGHTVYDKAGRKFVFNLAPSGLLLPGKRNYIG 240
146080968 241 PECVMDPVSFMEKEIIQLIDAGIDYRDRLFIGNVCIVTPYHKLLDLLGSAANSSTLKGMAPVHGSKVMKRGIRLDHIFND 320
154333968 241 PECVMDPVSFMEKEIIQLISAGIDYHDRLFIGNVCIVTPYHKLLDLLGSAANSSTLKGMAPVHGSKVMKRGIRLDHIFND 320
157866314 241 PECVMDPVSFMEKEVIQLIDAGIDYRDRLFIGNVCIVTPYHKLLDLLGSAANSSTLKGMAPVHGSKVMKRGIRLDHIFND 320
146080968 321 DETLRKRLEKDMDTYLGLLKVKNLSDADVVRLCREENSDGVVRVPDYVIAFAQAKDKVEFLVKLYRDRVRHNPDFPARCD 400
154333968 321 DETLRKRLEKDMETYLGLLKVKNLSDADVVRLCREENSDGVLRVPDYVIAFAQAKEKVKFLMNLYHDRVRNNPDFPARCD 400
157866314 321 DETLRKRLEKDMDTYFGLLKVKNLSDADVVRLCREENSDGVVRVPDYVIAFAQAEDKVEFLVKLYRDRVRHNPGFPARCD 400
146080968 401 VTYELHAAVLRGEKVLLEGPQSYWLSNARTKFWESTTSADTTAAGLLAASQLNFQKFKSVVLNVHKAPGSSRVGIGACPS 480
154333968 401 VIYELRAAVLRGEKVLLEGPQSYWLSNARTKFWESTTSADTTAAGLLAASQLNFQQFKSVVLNVHKAPGSSRVGIGACPS 480
157866314 401 VTYELHAALLRGEKVLLEGPQSYWLSNARTKFWESTTSADTTAAGLLAASQLNFQKFKSVVLNVHKAPGSSRVGIGACPS 480
146080968 481 SFVPQDYFSAQNIKTLRDLPSETCANFEAVQRTLFRDGFPHSNDKARHNGIMAPVEYSDETGKYNIGVAMAIASAQHHGE 560
154333968 481 SFVPQDFFSAQNIKTLHDLPPATCANFEAIQRTLFRDGFPYSNDKAKHNGIMAPVEYSDETGDYNIGVAMAIASAQHHGE 560
157866314 481 SFVPQDYFSAQNIKTLRDLPSATCAHFEAVQRTLFRDGFPHSNDKARHNGIMAPVEYSDETGTYNIGVAMAIASAQHHGE 560
146080968 561 CGAVTKKPRVCGFFDCVLQHEVNSIQGPYLTISALDRGDEYDKVGVTIAYVYYNPEGKQVDVNGHVYKNGDIIRAGDPVP 640
154333968 561 CGAVTKKPRVCGFFDCVLQHEVNSIQGPYLTISALDRGDEYDKVGVTIAYVYYNPEGKQVNVNGHVYKNGDIIRAGDPVP 640
157866314 561 CGAVTKKPRVCGFFDCVLHHEVNNIQGPYLTISALDRGDEYDKVGVTIAYVYYSPEGKQVDVNGHVYKNGDIIRAGDPVP 640
146080968 641 SEPALYHCHPIVKLIDGWRDNPIAAAKRRRNAPLPRGVCELLSTIEYFTNCKILSIGNGPNGDDIIYLRQ 710
154333968 641 SESALYHCHPIVKLIDGWRDNPIAAAKRRRNTPLPRGLCELLSTIEYFTNCKVLSIGNGPNGDDIIYLRQ 710
157866314 641 SEPALYHCHPIVKLIDGWRDNPIAAAKRRRNAPLPRGVCELLSAIEYFTNCKILSIGNGPNGDDIIYLRQ 710
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap