Conserved Protein Domain Family
PTZ00348

?
PTZ00348: PTZ00348 
tyrosyl-tRNA synthetase; Provisional
Statistics
?
PSSM-Id: 173541
View PSSM: PTZ00348
Aligned: 5 rows
Threshold Bit Score: 1286.39
Threshold Setting Gi: 71657803
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72391382    9 GSVEERFKLIRSVGEECIQENELRAMLEKKPDIRCYDGFEPSGRMHVAQGVFKSINVNKCTQSGCEFVFWVADWFALMND 88 
154334377   1 MNADERYELLRSVGEECIQDAELRSLIERKPAIRCYDGFEPSGRMHIAQGIFKAVNVNKCTTAGCEFVFWVADWFALMND 80 
157866691   1 MNTDERYKLLRSVGEECIQESELRNLIEKKPLIRCYDGFEPSGRMHIAQGIFKAVNVNKCTAAGCEFVFWVADWFALMND 80 
146081729   1 MNTDDRYKLLRSVGEECIQESELRNLIEKKPLIRCYDGFEPSGRMHIAQGIFKAVNVNKCTAAGCEFVFWVADWFALMND 80 
71657803    9 MTTEERYALVRSVGEECIQEEELLNLITKKPNIRCYDGFEPSGRMHIAQGVFKAVNVNKCTQSGCEFVFWVADWFALMND 88 
72391382   89 KVGGELQRIRIVGEYLTEVWKAANMNMERVRFLWSSDEITNNANTYWKLVLDISRRNTIARIKKCCTIMGKQEGTLTAAQ 168
154334377  81 KVGGELEKIRIVGRYLIEVWKAAGMDMDKVVFLWSSEEITNHAGTYWRTVLDVGRQNTIARIKKCCTIMGKTEGTLTAAQ 160
157866691  81 KVGGELEKIRIVGRYLIEVWKAAGMDMDKVLFLWSSEEITSHADTYWRMVLDIGRQNTIARIKKCCTIMGKTEGTLTAAQ 160
146081729  81 KVGGELEKIRIVGRYLIEVWKAAGMDTDKVLFLWSSEEIMSHADTYWRMVLDIGRQNTIARIKKCCTIMGKTEGTLTAAQ 160
71657803   89 KMCGELEKIRIVGQYLIEVWKAAGMNMEKVIFLWSSDEITRNANSYWKTVLDIGRRNTIARIKKCCTIMGKQEGTLTAAQ 168
72391382  169 VLYPLMQCADIFFLKADICQLGLDQRKVNMLAREYCDLIGRKNKPVILSHHMLAGLKQGHAKMSKSDPDSAIFMEDSEED 248
154334377 161 VLYPLMQCTDIFFLKADICQLGLDQRKVNMLAREYCDFIGRKLKPVILSHHMLAGLKQGQAKMSKSDPDSAIFMEDTEED 240
157866691 161 VLYPLMQCCDIFFLKADICQLGLDQRKVNMLAREYCDLIGRKLKPVILSHHMLAGLKQGQAKMSKSDPDSAIFMEDTEED 240
146081729 161 VLYPLMQCCDIFFLKADICQLGLDQRKVNMLAREYCDLIGRKLKPVILSHHMLAGLRRGQAKMSKSDPDSAIFMEDTEED 240
71657803  169 ILYPLMQCADIFFLKADICQLGLDQRKVNMLAREYCDLIGRKLKPVILSHHMLSGLKEGQPKMSKSDPDSAIFMEDTRED 248
72391382  249 VARKIRAAYCPRVAQKSTEVTDDGAPVASEDKNPVLDYFECLVFSKPGATAVVDGAEYNTYADLEKAFVDGNISEEALKE 328
154334377 241 VTRKIRQAYCPRVKQSANVITDDGAPVATDDRNPVLDYFQCVVYARPGAVATIDGATYATYEDLEQAFVSDKVSEVALKS 320
157866691 241 VARKIRQAYCPRVKQSASAITDDGAPVATDDRNPVLDYFQCVVYARPGAAATIDGTTYATYEDLEQAFVSDEVSEDALKS 320
146081729 241 VARKIRQAYCPRVKQSASAITDDGAPVATDDRNPVLDYFQCVVYARPGAVAAIDGTTYATYEDLEQAFVSDEVSEDALKS 320
71657803  249 VERKIRHAYCPRLRQKKAEVPEDGAPVSSEEKNPVLDYFQHVIYSRPAASTTINGTLYKTYEELEEAFVDGTITEELLKD 328
72391382  329 GLIELLNGILEPVRKHFVEDPHAASLLQQVLSFRAGGAAPPLSAVPLPEQSATPLAVAWLPACIKFPVDLAVALSDAIKQ 408
154334377 321 CLIDEVNALLAPVRQHFASNPEAHELLETVKSYRKDGAVLPLAEAALPAAPEKPHACMWMPALVKVPLDVAEGMIQAAKD 400
157866691 321 CLIDEVNALLEPVRQHFASNEEAHELLEAVKSYRKDGATLPLAETALPAAPAKPHACMWMPALLKVPLDVAEGMIKVTKD 400
146081729 321 CLIDEVNALLAPVRQHFASNEEAHELLEAVKSYRKGGATLPLAETALPAAPEKPHACMWMPALLKVPLDVAEGMIKATED 400
71657803  329 ALALELNALLEPVRHHFACDPHAAGLLEKVKSFRKGGQTPPLTDIGPFEQSETPLAVVWLPTVIKLSVNVAVAISDAVKA 408
72391382  409 FLRENTDGEAVLLLPEWTAMACNNVGGEEKYISAALELNAAILKSHWLPSErVRIVRQSEMILANPNDYWLTAINVGRKN 488
154334377 401 FIAAHSEGTVTLVLPDWSAVASDEITGMEKDISAALHVNSTLLKAYGLPEA-VKLVMENDVILGNPNDFWVSVIGIARKN 479
157866691 401 FIAAHPEGTVTLVLPDWSAVASDEITGVEKDISAALQVNCALLKAYGLPSS-VKIVTENEVILGNCDDFWVSVIGIARKN 479
146081729 401 FIAAHPGGTVTVVLPDWSAVASDEITGVEKDISAALQVNCALLKAYGLPNS-VKIVTENEVILGNRNDFWVSVIGIARKN 479
71657803  409 FLEQHSDGEVVLLLPEWTAFSCGEVTGEEKNISAALELNLALLQATYLRKEwVRVVRQSQLILDNPNDYWVAAINAGRRN 488
72391382  489 KLQRVEEVC-GDLKNAGAVVAALMYVADAAMLKATHAICTSHDRGCHEIATDFYEGKLRVIPALGGVVPPLSNAEPpvse 567
154334377 480 LLSHVEELYgGELRNAGQVIAALMRVATTLMLSASHVISTSLDGQINTFAREYTKGRIECLQAQEGRVPALHRPGA---- 555
157866691 480 LLSHVEELYgGEVRNAGQVIAALMRVATALMLSVSHVISTSLDGHINAFAREYTKERIDCVQTLEGRIPALHRPGA---- 555
146081729 480 LLSHIEELYgGELRNAGQVIAALMRVATALMLSVSHVISTSLDGHINAFAREYTKERIECVQTLEGRIPALHRPGA---- 555
71657803  489 MLQYLGDVC-GEFKAAGDLVAALMYVADVAMLKATHIISAPHERGYHEVVKKFFDGRVTAIPAREGTVPPLHRPEA---- 563
72391382  568 tlASGPVNKDDILFIDDTDMDMRRKIKRAYCAPNEDANPVLSIATWLMREQGALLIERTEANGGDVAYKGEGQLRADALS 647
154334377 556 --APAVLGADDVLYLDDNDMDIRRKIKKAYSAPNEEANPIISVAQHLLAQQGVLSIERGEANGGSVRYDTPEGLVADCSS 633
157866691 556 --APAVLGADDVLYLDDNDMDIRRKIKKAYSAPNEEANPVISVAQHLLAQHGALSIERGEANGGNVSYNTPEALVADCGS 633
146081729 556 --APAVLGADDVLYLDDNDMDIRRKIKKAYSAPNEEANPVISVAQHLLAQHGALNIERGEANGGNVSYNTPEALVADCGS 633
71657803  564 ----LVAGADDVLFLDDTDMDTRRKIKKAYCAPNEAANPVLSIAAWLLRERGTLTVERAAENGGNVAYTSEARLRDDAQS 639
72391382  648 GALHPADLKQAVSKMLLDKCAAAKAVLStAEGKKYAQTLKNAEKSLSKSK 697
154334377 634 GALHPADLKATVSQLLLHRSAAARALLS-GELKKSIATLRNMEKMAKRRS 682
157866691 634 GALHPADLKAAVLQLLLDRSAQARALLN-GELKKNMTVLRNAEKKMAKKR 682
146081729 634 GALHPADLKAAVLQLLLDRSAQARALLN-GELKKNMTALRNAEKKMAKKR 682
71657803  640 GTLHPADLKAAVTKPLLEVCAVSKAVLSsAEGKKLSQTLRQAEKTLSKRS 689
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap