Conserved Protein Domain Family
PTZ00341

?
PTZ00341: PTZ00341 
Ring-infected erythrocyte surface antigen; Provisional
Statistics
?
PSSM-Id: 173534
View PSSM: PTZ00341
Aligned: 2 rows
Threshold Bit Score: 1696.51
Threshold Setting Gi: 124505681
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124804971    1 MKPYSSYSSAFSKQYMGTKSVKAKNPTIYSF-EEEKQNENMSLLKSLCSKRLVLPILGILYIILNGNFGYNGSSNSGAQF 79  
124505681    1 MRPFHAYSWIFSQQYMDTKNVKEKNPTIYSFdDEEKRNENKSFLKVLCSKRGVLPIIGILYIILNGNLGYNGSSSSGVQF 80  
124804971   80 TDRCSRNLYCETLPINPYADSENPIVVSQVFGLPSEKPTFTLEGTPDIDHTNILGFNEKLMTDVNRYRYSNNYEAIPHTR 159 
124505681   81 TDRCSRNLYGETLPVNPYADSENPIVVSQVFGLPFEKPTFTLESPPDIDHTNILGFNEKFMTDVNRYRYSNNYEAIPHIS 160 
124804971  160 EFNPLIVDKVLFDYNEKVDNLGRSGGDIIKKMQTLWDEIMDINKRKYDFLKTKLQKTYSQYKVQYDMPKEVYESKWGQCL 239 
124505681  161 EFNPLIVDKVLFDYNEKVDNLGRSGGDIIKKMQTLWDEIMDINKRKYDSLKEKLQKTYSQYKVQYDMPKEAYESKWTQCI 240 
124804971  240 KLINQGGDNLEERLNTQFKNWYRQKYLNLEEYRRLTVLNQIAWKALSNQIQYTCRKIMNSNISSFKHISELKSLEQRAAK 319 
124505681  241 KLIDQGGENLEERLNSQFKNWYRQKYLNLEEYRRLTVLNQIAWKALSNQIQYSCRKIMNSDISSFKHINELKSLEHRAAK 320 
124804971  320 DAQEEMRKRAEKQKKKKSkRRGWLCCGGGDNETVEPQQEEPVQDVGEHQINEYGDILPSLKVSINNSAINYYDAVKDGKY 399 
124505681  321 AAEAEMKKRAQKPKKKKS-RRGWLCCGGGDIETVEPQQEEPVQTVQEQQVNEYGDILPSLRASITNSAINYYDTVKDGVY 399 
124804971  400 LDDDSSDALYTDEDLLFDLEKQKYMDMLDGSEDESVEDNEEEHSGEaneeelsvDENVEEQNVDEsgeqqsddesgehqs 479 
124505681  400 LDHETSDALYTDEDLLFDLEKQKYMDMLDTSEEESVKENEEEHTVD--------DEHVEEHTADD--------------- 456 
124804971  480 vneiveeqsvnEIVEEQTVDEiveqetvDENVEEQAVdeneeqqtVDENVEQQTIDESQVQEEiSTIQENIEEVVSEVQQ 559 
124505681  457 -----------EHVEEPTVAD-------DEHVEEPTV--------ADEHVEEPTVAEEHVEEP-TVAEEHVEEPASDVQQ 509 
124804971  560 DSEVDRTLHVPDTRFYDILGVGVNADMKEISESYFKLAKQYYPPKYSVNEGMLKFKQISEAYQILGDIDKRKMYNKFGYD 639 
124505681  510 TSEAAPTIEIPDTLYYDILGVGVNADMNEITERYFKLAENYYPYQRSGSTVFHNFRKVNEAYQVLGDIDKKRWYNKYGYD 589 
124804971  640 GIKGVNFIHPTIYYMLASLEKFAFYTGSPQIVTLMKFLFEKKLTVNDLDTKSEHLSKIMGVYQKERETYISENLISRLQP 719 
124505681  590 GIKQVNFMNPSIFYLLSSLEKFKDFTGTPQIVTLLRFFFEKRLSMNDLENKSEHLLKFMEQYQKEREAHVSEYLLNILQP 669 
124804971  720 YIDSIRNWDVQIKDQIYELMGSPFDIAIIDSIGWTLQYVSMSHMKNPKKAIKKLETRSKKNKETVAYENNKLMNILREYF 799 
124505681  670 CIAGDSKWNVPIITKLEGLKGSRFDIPILESLRWIFKHVAKTHLKKSSKSAKKLQQRTQANKQELANINNNLMSTLKEYV 749 
124804971  800 GNNEQINSITYNMEYNTLNENNENGYRKILNLNHKKQKKLFEEIISYIVNISLSDIENTVKNSAESILTVEGLDEKKLSK 879 
124505681  750 GSSEQMNSITYNFENINSNVDNGNQSKNISDLSYTDQKEILEKIVSYIVDISLYDIENTALNAAEQLLSDNSVDEKTLKK 829 
124804971  880 RIESLRMLANAIRKYILRGKKGKKYKNKDAKSLSGNIANEINLINKELQN--------LKEHTQANIPEHIEENVQENME 951 
124505681  830 RAQSLKKLSSIMERYAGGKRNDKKAKKYDTQDVVGYIMHGISTINKEMKNqnenvpehVQHNAEANVEHDAEENVEHDAE 909 
124804971  952 ENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENIEENVEENVEENIEEN---------------------- 1009
124505681  910 ENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENVEENveeydeenveeveenveeydee 989 
124804971 1010 ----IEENAEENVEENIEENIE-------ENIEENIEENIEENVEENVEEN---IEENVEENVEENAEENAEENAEENAE 1075
124505681  990 nveeVEENVEENVEENVEENVEeydeenvEEVEENVEENVEENVEENVEENveeVEENVEENVEENVEENVEENVEENVE 1069
124804971 1076 E-NDETPQEHNEEYDE 1090
124505681 1070 EyDEENVEEHNEEYDE 1085
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap