Conserved Protein Domain Family
PTZ00330

?
PTZ00330: PTZ00330 
acetyltransferase; Provisional
Statistics
?
PSSM-Id: 140351
View PSSM: PTZ00330
Aligned: 6 rows
Threshold Bit Score: 230.499
Threshold Setting Gi: 71649600
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71663878    2 SDDLGELELREVEEGDVPSLLDLLRHLTDAPAVTASALQAIAEARRQAGMVTKVFIHRPTRRVVGTASLFVEPKFSRGGK 81 
71649600    2 SDELGELELRELEEGDVPSLLDLLRHLTDAPAVTTSALRAIAEARRQAGMVTRVFIHRPTRRVVGTASLFVEPKFSRGGK 81 
74025218    1 MTDIVDLELRVLEESDLSSHLELLGHLTEAPPLSGVELANIADMRRRAGIVTKVFCHQPTGGIVGSASLMIQPKFTRGGR 80 
154340783   1 --MSGSIVIRDLETRDLGEVLALLSHLTSTPVLSQEELEQVHARRVLAGVRTRVAVDSTTQQILGTASLIVEPKFTRGGK 78 
146092644   1 --MSSSIVIRDLETRDLGEVLELLSHLTSAPALSQEELEQLHARRVLAGVRTRVAVSSTTQKILGTASLVVEPKFTRGGK 78 
157872076   1 --MSSSIIIRDLETCDLGEVLELLSHLTSAPALSQEELEQLHARRVLAGVRTRVAVSSTTQKILGTASLIVEPKFTRGGK 78 
71663878   82 SVGHIEDVVVDPSYRGKKLGQALIGDLCNIARSRGCYKVILDCAEAAIEFYKKLGFEARERQMRLDL 148
71649600   82 SVGHIEDVVVDPSYRGKKLGQALIGDLCNIARSRGCYKVILDCAEAAIEFYKKLGFEARERQMRLDL 148
74025218   81 AVGHIEDVVVDPSYRGAGLGKALIMDLCEISRSKGCYKVILDSSEKSLPFYEKLGFRAHERQMRLDL 147
154340783  79 CVGHVEDVVTHPDRRDQGIGRKLLSNLVEIAVASNCYKVILDCTDDMVAYYCKAGFRKCENQMRLNI 145
146092644  79 CVGHVEDVVTHPDCRGQGIGRELLSDLVEVARASYCYKVVLNCTDDMVAYYSKAGFRKCENQMRMNI 145
157872076  79 CVGHVEDVVTHPDCRGQGIGRELLSSLVEVARASDCYKVVLNCTDDMVAYYSKAGFRKCENQMRMSI 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap