Conserved Protein Domain Family
PTZ00328

?
PTZ00328: PTZ00328 
eukaryotic initiation factor 5a; Provisional
Statistics
?
PSSM-Id: 140349
View PSSM: PTZ00328
Aligned: 11 rows
Threshold Bit Score: 337.411
Threshold Setting Gi: 154338682
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71659671    1 MSDDEGNFTQQGGEQTGSLTYPMQAGALKKGGYICINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNKMEDQAPTTH 80 
71659667    1 MSDDEGNFTQQGGEQTGSLTYPMQAGALKKGGYICINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNKMEDQAPTTH 80 
71754505    1 MSDDEGQFA-EGGAQVGSLTYPMQAGALKKGGYICINGRPCKVIDLSVSKTGKHGHAKVSIVALDIFTGNKMEDQAPSTH 79 
146088631   1 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80 
146088636  92 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 171
154338682   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80 
154338684   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80 
154338686   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80 
154338688   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80 
157870552   1 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80 
157870554   1 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80 
71659671   81 NVDVPFVKTSTYSVLDIQEDrTDPSKPAHLSLMDDEGETRDNLDMPPNAELAAQIKEQFEAGKDVLVVVVSAMGTDQILS 160
71659667   81 NVDVPFVKTSTYSVLDIQEDrTDPSKPAHLSLMDDEGETRDNLDMPPNAELAAQIKEQFEAGKDVLVVVVSAMGTDQILS 160
71754505   80 NVEVPFVKTATYSVLDIQEDrEDPSKPAHLSLMDDEGETRDNLDMPPNAELAGQIKEQFDAGKDVLVVVVSAMGIDQILS 159
146088631  81 NVEVPFVKTFTYSVLDIQPN-EDPSLPSHLSLMDDEGESREDLDMPPDVALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
146088636 172 NVEVPFVKTFTYSVLDIQPN-EDPSLPSHLSLMDDEGESREDLDMPPDVALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 250
154338682  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
154338684  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
154338686  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
154338688  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
157870552  81 NVEVPFVKTFTYSVLDIQPN-EDSSLPSHLSLMDDEGESREDLDMPPDAALAAQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
157870554  81 NVEVPFVKTFTYSVLDIQPN-EDSSLPSHLSLMDDEGESREDLDMPPDAALAAQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
71659671  161 FKNAVEK 167
71659667  161 FKNAVEK 167
71754505  160 FKNAAER 166
146088631 160 TKNAAEK 166
146088636 251 TKNAAEK 257
154338682 160 TKNAAEK 166
154338684 160 TKNAAEK 166
154338686 160 TKNAAEK 166
154338688 160 TKNAAEK 166
157870552 160 TKNAAEK 166
157870554 160 TKNAAEK 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap