Conserved Protein Domain Family
PTZ00322

?
PTZ00322: PTZ00322 
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional
Statistics
?
PSSM-Id: 140343
View PSSM: PTZ00322
Aligned: 6 rows
Threshold Bit Score: 1210.5
Threshold Setting Gi: 71662856
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71408033    1 MSFLICSVIHATFAALLFFfffffwvcavslctgvlyfflsviiyrwvpttmpvmpatlGTRGGGEQTAKPSSFERMAAI 80 
71662856    5 MSFLICSVIHVTFAALLFFffflcvcavslctgvihffv-sviiycwvpttmpvmpatlGTRGGGEQTAKPSSFERMAAI 83 
72390982    1 MDCLVCS----------------------------------------------------------GRLPVQTAFNRMAAI 22 
154339149   5 SLTTGVASASPALTSQRYS----------------------------------------GIEASRKRRQKPISFQRMAMI 44 
146089420   5 SPPPVVATASSAVAPQPFG----------------------------------------GAETSRKRRLKPISFHRMAMI 44 
157870977   5 APPPVLGTASSAVAPQPFG----------------------------------------GSEASRKRRLKPISFQRMAMI 44 
71408033   81 QEEIAKIETRLRSLQSTEDADDTP-----WTSAPQEDMDPAVAKMLSVELCHLAASGDSVGVRLLLESGADTDCRDYDEQ 155
71662856   84 QEEIAKIETRLRSLQSTEDADDTP-----WTSAPQEDMDPAVAKMLSVELCHLAASGDSVGVRLLLESGADTDCRDYDEQ 158
72390982   23 QEEIARIDDQLATLYLTENMAATSp----KEAPTDESIDQTIAHMLAVELCQLSASGDTVGIRVLLSGGADCNCVDYHGR 98 
154339149  45 QEEIARINQHLEALEASENKTAGPdsvgqHNLTPEDVVDPVVLHMLTVELCELAASGDAVGARILLTGGADPNSRDYDGS 124
146089420  45 QEEIARIDKHLEALEASESKVVDPdpvgqHNLTTEDVIDPVVLHMLTVELCQLAASGDAVGARILLTGGADPNSRDYDGR 124
157870977  45 QEEIARIDKHLEALEASESKVVDPdsvgqHNLTTEDVIDPVVLHMLTVELCQLAASGDAVGARILLTGGADPNSRDYDGR 124
71408033  156 TPLHIASALGHVQVVRLLLEFGADPTLLDKDDKTPFRLAGENNRREVVQLLLRHSQEHgHELDACGKPDSF--------L 227
71662856  159 TPLHIASALGHVQVVRLLLEFGADPTLLDKDDKTPFRLAGENNRREVVQLLLRHSQAHgHELDACGKPDSF--------L 230
72390982   99 TPLHLACLMGHVTVARVLLEFGADVTATDKEGKTPMDLAVRSDTREIVELLMSHCICD-SSGGARSPPQELdgvlgeglQ 177
154339149 125 TLLHIACTNGRLGVVMVLLEFGADPSLLDRDGNTPLEVAEENGFGDVVQALSRC-----FNFGANAAPDSFtgq--pssL 197
146089420 125 TLLHIACMNGRLSVVTVLLEFGADASLLDRDGNTPLEVAEENGFGDVAQLLSGY-----FDAEANAVPDSFtgk--ppsF 197
157870977 125 TLLHIACMNGRLSVVTVLLEFSADASLLDRDGNTPLEVAEEYGFGDVAQVLSGY-----FDAGANAVPDSFtwk--ppsF 197
71408033  228 LDSPIMSAHPDFSQIPQPMMGSLIVIMVGLPGRGKTYIARQIQRYFKWNGLQSRIFIRSTYKEKLE--------EGGVVS 299
71662856  231 LDSPIMSAHPDFSQIPQPMMGSLIVIMVGLPGRGKTYIARQIQRYFKWNGLQSRIFIRSTYKGKLE--------EGGAVS 302
72390982  178 EDSPLTATHPDFSSLPRPMMGSLIVIMVGLPARGKMYTARQIQRYFQWNGLQSSIFTYDNYVHQLAp-------RQPASC 250
154339149 198 ELSPASMHAPDFSAVPQPMLGSLIVIMVGLPGRGKTYVAEQIRRYFQWNGLACRIFSHQACRRRVErtmtegvdRDASVL 277
146089420 198 ESTPVSMHQPDFSAVPQPMLGSLIVIMVGLPGRGKTYVAEQIRRYFQWNGLTCKIFSHQACRRRVEramtdradRGDDVS 277
157870977 198 ESTPVSIHQPDFSAVPQPMLGSLIVIMVGLPGRGKTYVAEQIRRYFQWNGLTCKIFFHQACRRRVEramtdradRDADVS 277
71408033  300 TALSAAEVERRIAAAIAKDMTQFIDETDGVAVLNGTNCSPLRRMALMSAIRETGLIRPNRVIFVEVVNNNSEIVRLNVNR 379
71662856  303 TALSAAEVERRIAAAIAKDMTQFIAETDGVAVLNGTNCSPLRRMALMSAIRETGLIRPNRVIFVEVVNNNSEIVRLNVNR 382
72390982  251 DITQDVDMELRVAKAIAHDMTHFIHQEDGVAVLAGSNVTSVRRMALFNAVMETGHIRQGRVVFVEVINTVSERIRNNVLL 330
154339149 278 SPTGVAEVEFRIAKELAHDLTTYICKTSGVAILDGTQTTHARRQYLLRAIRDTRQINMTRVVFVEVVNNNKETIHRNILH 357
146089420 278 SPTGATELEFRISKELAHDLTTYICKTSGVAILDGTQTTHARRQYLLRAIRDTRLINMTRVVFVELVNNNKETIHRNILR 357
157870977 278 SPTGATELEFRISKELAHDLTTYVCKTSGVAILDGTQTTHARRQYLLRAIRDTRLINMTRVVFVELVNNNKETIHRNILL 357
71408033  380 KKEINPGATQSFVDQYYARIERLNALYKSLSPTTDRDLTYILIEDQTTFALNNISGWMPSRLSYMLHNLNHAPSNLYLTR 459
71662856  383 KKEINPGATQSFVDQYYARIERLNALYKSLSPTTDRDLTYILIEDQTTFALNNISGWMPSRLSYMLHNLNHAPSNLYLTR 462
72390982  331 AKEMVTGASDRFVEEYYEKMEQLEAVYTSLDPVVDKDLTYIRVENGEVFSLNNISGWMPSRLAYMLHNLNPCSHNIYLTR 410
154339149 358 AKEMFPNAPEDFVDRYYKVMAQHEAVYKTLNPVTDCDMSYIRIEDTQTYSLNMISGWMPSRLAFMLHNLSQTPMNLYLTR 437
146089420 358 AKEMFPNTPEDFVDRYYEVIKQHEAVYKTLNPLTDCDMPYIRIEDTQTYSLNMITGWMPSRLAFMLHNLSPTPMNLYLTR 437
157870977 358 AKEMFPNTPEDFVDRYYEVIKQHEAVYKTLNPLTDCDMPYIRIEDTQTYSLNMITGWMPSRLAFMLHNLSPTPMNLYLTR 437
71408033  460 AGEYVDLIAGRIGGNSRLTERGQAYSEALFEYFQGEL-QMKSFTVMSSCALRCIETVQYFEEQSVLQRSSASAAQIK--- 535
71662856  463 AGEYVDLIAGRIGGNSRLTERGQAYSEALFEYFQGEL-QMKSFTVMSSCALRCIETVQYFEEQSVLQRSSASAAQSR--- 538
72390982  411 SGEYIDLVDQRIGGNSPLTERGRAYGRAIFEYFRREH-GAERFVVMSSCAVRCTETVHYFDKRNELSQDPYFASGST--- 486
154339149 438 AGEYVDLLSDRIGGNSRLTERGRAYSRVLFEYFHKEIpSTTSLTVMTSCAKRCTQTVHYFAEESIKHHSTPTTASEQvvd 517
146089420 438 AGEYVDLLSDRIGGNSRLTERGRAYSRALFEYFQKEIpSTTALTVMTSCAKRCTQTVHYFAEESIKCQSTANPASGQeeg 517
157870977 438 AGEYVDLLSNRIGGNSRLTARGRAYSRALFEYFEKEIpSTTALTVMTSCAKRCTQTVHYFAEESIKCQSTANPASEQagg 517
71408033  536 EPKLNCRVAYFPTLDSLNHGDCDGQLLSDVRRAMPSTLLHMQADPYHTAWPNGECVHQLYNARLEPHIHDIQASTEPVLV 615
71662856  539 EPKLNCRVAYFPTLDSLNHGDCDGQLLSDVRKAMPSTLLHMQADPYHTAWPNGECVHQLYNARLEPHIHDIQASTEPVLV 618
72390982  487 SPAVNCRVSYLPTLDDINRGDCEGMLLSDVRRTMPGTLRNILDDPYLTAWPNGECTHQVFNARLEPLIHDIQASDHSVLV 566
154339149 518 SPSLRCRVLYFPTLDDINHGDCEGQLLSDVMRTMPNTLQSMKADPYYTAWPNGECIHQVFNSRLEPHIHDIQASTTPVLV 597
146089420 518 KPSLRCRVLYFPTLDDINHGDCEGQLLSDVLRTMPNTLQSMKADPYYTAWPNGECIHQVFNSRLEPHIHDIQASTTPVLV 597
157870977 518 KPSLRCRVLYFPTLDDINHGDCEGQLLSDVLRTMPNTLQSMKADPYYTAWPNGECIHQVFNSRLEPHIHDIQASTTPVLV 597
71408033  616 VSHLQLLQGLYSYFVSENDDFVAPQDAYKIDIPFESVIKIRLVGFNRVAETIDLSKEVDRIQHRRTGKVTKATQQSSlni 695
71662856  619 VSHLQLLQGLYSYFVSENDDFVAPQDAYKIDIPFESVIKIRLVGFNRVAETIDLSKEVDRIQHRRTGKVTKATQQSSlni 698
72390982  567 VSHLHLLQGLYSYFVCKDGNVIAPQNAYTIDIPLECVVKIRRVGDNRVAEIIDLSHEVDRIAQLYHGGAQRHCRRTE--- 643
154339149 598 TSHLHLLQGLYSYFVTDGDNIVAPQNAFKIDIPLEHVVKIRMVGVNRVAELIDLSEAVVAIQRSETELST---------- 667
146089420 598 ASHLHLLQGLYSYFVTDGDNIVAPQNAFQIDIPFEHVIKIRMVGLNRVAELIHLSDAVDAILRSDTELYT---------- 667
157870977 598 ASHLHLLQGLYSYFVTDGDKIVAPQNAFQIDIPFEHVIKIRMVGLNRVAELIHLSDAVDAILQSDTELCT---------- 667
71408033  696 fcRSGKK 702
71662856  699 fcRSGKK 705
72390982  644 --DFNKL 648
154339149     -------    
146089420     -------    
157870977     -------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap