Conserved Protein Domain Family
PTZ00320

?
PTZ00320: PTZ00320 
ribosomal protein L14; Provisional
Statistics
?
PSSM-Id: 140341
View PSSM: PTZ00320
Aligned: 6 rows
Threshold Bit Score: 346.254
Threshold Setting Gi: 72387638
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154336773   1 MLRLFRARLAPT-TTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYRSRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRL 79 
71395987    1 MFRRWGLRLAAT-TTDAAAKLPAGNPVNKSWFRYNLIIRRKASYRSRWGTGAEGYGTGVPFSDQVKLHCVDNTNCKHVRL 79 
71663945    1 MFRRWGLRLAAT-TTDAAAKLPAGNPVNKSWFRYNLIIRRKASYRSRWGTGAEGYGTGVPFSDQVKLHCVDNTNCKHVRL 79 
72387638    1 MFRFFSLRLAPApSADAAAKLPAGKPANKSWFRHNLIIRRKASYRSRWGTGAEGYGTGVPFSDQVKLHCVDNTNCKHVRL 80 
146099698   1 MLRFFRARLAPT-TTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYRSRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRL 79 
157876257   1 MLRFFRARLAPT-TTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYRSRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRL 79 
154336773  80 IAKATAERFAHCRVFPAVAHRVSVQRFKgrGGGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQR 159
71395987   80 ISKATAERFAHCRVFPAVAHRVSVQRFK--SGRGEVSRHRVKPGNIYWVCLLSRRQTNTRMSGLQTNFDRNTCILLNDQR 157
71663945   80 ISKATAERFAHCRVFPAVAHRVSVQRFK--SGRGEVSRHRVKPGNIYWVCLLSRRQTNTRMSGLQTNFDRNTCILLNDQR 157
72387638   81 ISKATAERFAHCRVFPAVAHRVSVQRFK--SGRGEVSRHRVKPGNIYWVCLLSRRQTNTRMSGLRTNFDRNTCILMNDQR 158
146099698  80 IAKATAERFAHCRVFPAVAHRVSVQRFKgrGRGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQR 159
157876257  80 IAKATAERFAHCRVFPAVAHRVSVQRFKgrGGGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQR 159
154336773 160 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 190
71395987  158 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFI 188
71663945  158 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFI 188
72387638  159 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 189
146099698 160 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 190
157876257 160 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap