Conserved Protein Domain Family
PTZ00319

?
PTZ00319: PTZ00319 
NADH-cytochrome B5 reductase; Provisional
Statistics
?
PSSM-Id: 173521
View PSSM: PTZ00319
Aligned: 7 rows
Threshold Bit Score: 510.914
Threshold Setting Gi: 167527319
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146080942   1 MVGVLVIIAFSMAAFF--AFM------FTRTTKVAMDPTMFKHFKLIKRTEVTHDTFIFRFALENETQTLGLPIGQHIVL 72 
71411118    4 YVVAAVIIVLTVFLFFkkGVF------FSSSMGVALDASKFQNFKLVDKITVSHNSFIFRFALHSPTQRLGLPIGQHLHI 77 
71755083    1 -MMLAVIVAFAVIFFVtlALAgrgllpFYRYPPIALNPDVYQSFKLVKKTRVTHDSFIFRFALHASHQCLGLPTGHHIRF 79 
71653344    4 YVVAAVIILLTVCLFFkkGVF------FSSSMGVALDASKFQNFKLVDKITVSHNSFIFRFALHSPTQRLGLPIGQHLHI 77 
154333950   1 MIYLLVIIAVNMAAFF--AFM------YKRMAKVAMDPTMFKHFKLIKRTEVTHDTFIFRFALENETQSLGLPIGQHIVL 72 
157866288   1 MVGVLVIIAFGMAAFF--AFM------FTRTTKVAMDPTMFKHFKLIKRTEVTHDTFIFRFALENETQTLGLPIGQHIVL 72 
167527319  36 FGAGALLVGLGAAYYF-----------GHRSPPIALNPDQKIPFALIEKEVLSHDTTRFRFALQSPEHVLGLPVGKHMNF 104
146080942  73 RADCTTA--GKTETVTHSYTPISSDDEKGYVDFMIKVYFAGVHPSFPHGGRLSQYMYHMKLGEKIEMRGPQGKFIYLGNG 150
71411118   78 RCMTTNPd-GKPEMVQHAYTPVSSDDDLGHVDFLIKVYFKNVHPNFPNGGRLSQHLYDLPLGTMVEIRGPVGNFEYLGKG 156
71755083   80 RVASKHNftGTPQVVQHSYTPISSNDDKGFVDFLVKIYYKGSNPAFPNGGRLSQHLDSLSIGEAVEMLGPVGKFQYMGNG 159
71653344   78 RCMTTNPe-GKPEMVQHAYTPVSSDDDLGHVDFLIKVYFKNVHPNFPNGGRLSQHLYDLPLGTMVEIRGPVGNFEYLGKG 156
154333950  73 RADCTTS--GKTETVTHSYTPISSDDEKGYVDFMIKVYFAGVHPSFPHGGRLSQHLYHMKLGDKIEMRGPQGKFTYLGNG 150
157866288  73 RADCTTA--GKTETVTHSYTPISSDDEKGYVDFMIKVYFAGVHPSFPHGGRMSQHMYHMKLGDKIEMRGPQGKFIYLGNG 150
167527319 105 SCKVDGK------LVVRSYTPVSSNDEIGYFDMVIKVY-KPLPPRFPDGGKMSQYFDQMKIGDTIDVRGPAGHIEYARPG 177
146080942 151 TSRIHKPGKGI-VTEKVDAYAAIAGGTGITPILQIIHAIKKNKEDPTKVFLVYGNQTERDILLRKELDEaAANDSRFHVW 229
71411118  157 NYTVKDGKGKL-KKMHTDAFTMVAGGTGITPMMQLIRAIMKNKEDRTNIFLVYANQTEDDILLRKELDD-CAKDPRMKLW 234
71755083  160 DYTVEMGKGEV-KRQHVAGFAMVAGGTGITPMMQIIHAILKSPEDPTRLWLVYSNHTEEDILLRDALAE-ACKDPRVKVW 237
71653344  157 NYTVKDGKGKL-KKMHTDAFTMVAGGTGITPMMQLIRAIMKNKEDRTNIFLVYANQTEDDILLRKELDD-CAKDPRMKLW 234
154333950 151 TSRIQKPGQGF-ITDKVDAYAAIAGGTGITPILQIIHAIKKNKEDRTKVFLVYGNQTERDILLRKELDEaAANDDRFHVW 229
157866288 151 TSRIHKPGKGI-VTEKVDAYAAIAGGTGITPILQIIHAIKKNKEDPTKVFLVYGNQTERDILLRKELDEaAANDSRFHVW 229
167527319 178 VIILHKDKKSApIVKNVTKFAMIAGGTGITPCLQIIRAIKKNPADRTEVYLVFANKSEDDILLRKELDE-VAEDPRFHIW 256
146080942 230 YTIDREATPEWKYDIGYVCEEMFRKHLPVPDmlgsdsvPQNAGIKKVMALMCGPPPMVQMAIKPNLERIGYTADNIFNF 308
71411118  235 YMLDRETSPQWKYGTGYVDEATLRAHVPVLQ-------PRNSDYNRVVALMCGPPPMLQKAVKPNLEKLGYTAEDMFSF 306
71755083  238 HTLTRSAPPDWAYGRGRVNEEMLRTHLP----------PPQLEEGSVTVLLCGPPLMLQDAVKPNLLNIGYSQDNIFTF 306
71653344  235 YMLDRETSPQWKYGTGYVDEATLRAHVPVLQ-------PRNSDYNRVVALMCGPPPMLQKAVKPNLEKLGYTAEEMFSF 306
154333950 230 YTVDREVTPEWKFDVGYVREEMFRRHLPVPDmlgddsvPQNAGIKKVMALMCGPPPMVQMAIKPNLERIGYTADSMFNF 308
157866288 230 YTVDREATPEWKYDIGYVREEMFRKHLPVPDmlgndsvPQNVGIKKVMALMCGPPPMVQMAIKPNLERIGYTADNMFSF 308
167527319 257 YTIDK-AGPGWKYSEGYIDEAMLREHLPPVG-------------EDVQALMCGPPPMLKFACVPNLEKLGYRSDQMATF 321
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap