Conserved Protein Domain Family
PTZ00316

?
PTZ00316: PTZ00316 
profilin; Provisional
Statistics
?
PSSM-Id: 140337
View PSSM: PTZ00316
Aligned: 6 rows
Threshold Bit Score: 299.58
Threshold Setting Gi: 71410417
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71400168    1 MSWQAYIDDSLIGSGHMHSAAIVGLSDGSYWGYGGNYIPQPDEVAHILKCLGNFSLVQSSGVTIYGVKFFGLQSGEEGEM 80 
71410417    1 MSWQAYIDDSLIGSGHMHSAAIVGLSDGSYWGYGGTYIPQPDEVAHILKCLGNFSLVQSSGVTIYGVKFFGLQSGEEGEM 80 
74025736    1 MSWQSYVDDSLVGSGFMHSAAIVGLADGSYWAYGGTYVPQPEEVTHILKCLENFSLVQSSGVTICGVKFFGLQSGSEGQM 80 
146096265   1 MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSLVQSSGVNIYGVKFFGLQCGTDGDC 80 
154342939   1 MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYIPQPEEVKHIQKCLADFSLVQSSGVTIYGVKFFGLQCGTDGDT 80 
157873725   1 MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSFVQSSGVNIYGVKFFGLQCGTDGDC 80 
71400168   81 KYIFFKKGAAGGCIYTSKQTAIIAVYGNPGTSSSLQQDLEKKEGAEIAVNPADCNSTVKRIAEYLISLDY 150
71410417   81 KYIFFKKGAAGGCIYTSKQTAIIAVYGNPGTSSSLQQDLEKKEGAEIAVNPADCNSTVKRIAEYLISLDY 150
74025736   81 KYIFFKKGAAGGCIYTSKQTAIIAVYGNPGDASALQQDLQKTEATYVAVNPADCNTTVKRIAEYLISLDY 150
146096265  81 KYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLEKNTAHTVTVNPADCNTTVKRIADYLIKLGY 150
154342939  81 KHIFFKKGAAGGCIYTTKQAFIVAVYGDPGDTSSLQQALAKNASHAAAVNPADCNTTVKRIADYLVKLGY 150
157873725  81 KYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLEKNTAHAVTVNPADCNTTVKRIADYLIKLGY 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap