Conserved Protein Domain Family
PTZ00313

?
PTZ00313: PTZ00313 
inosine-adenosine-guanosine-nucleoside hydrolase; Provisional
Statistics
?
PSSM-Id: 140334
View PSSM: PTZ00313
Aligned: 6 rows
Threshold Bit Score: 611.482
Threshold Setting Gi: 72386929
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
73537053    2 PPKPVIIDHDGGHDDLVALALLLGNPEAVKVIGCIVTDADCFVDQAFSVSGKLMAMMHAREATELFPVAKTSFKGVNPFP 81 
71404206    1 MPKAVILDQDGNHDDIISLALLLARPEKVRVIGCICTDADCFVADAFNITGKLMCLLNKRANRPLFPIGISSLHGVNPFP 80 
71660754    1 MPKAVILDQDGNHDDIISLALLLAWPEKVSVIGCICTDADCFVADAFNITGKLMCLLNKRANRPLFPIGISSFHGVNPFP 80 
72386929    1 MAKTVILDHDGNKDDFVAMILLLSNPKKVNLIGCICTDADCFVENGFDVTGKIMCAMHRLIKTPLFPIGKSTATAVNAFP 80 
146093393   2 PPKPVIIDHDGGHDDLVALALLLGNPEAVKVIGCIVTDADCFVDQAFNVSGKLMAMMHAREATELFPVAKTSFKGVNPFP 81 
154341348   2 SPKPVIIDHDGGHDDLVALALLLGNPESVKVIGCIVTDADCIVDHAFSVSGKLMAMMHATEATGLFPVAKTSFKGVNPFP 81 
73537053   82 SEWRWSAKNMDDLPCVNIPEHVAIWEAVRDENDALVGEEVMAQLVMSSPEKVTICVTGPLSCVAWCIDKYGEEFCKNVEE 161
71404206   81 MEWRCTAKNMDDLPSLNIPEHTEMWEKLKPEYEKLVGEELLADLVMNSPEKVTICVTGPLSNVAWCIDKYGRRFTDKVEE 160
71660754   81 MEWRCSAKNMDDLPSLNIPEHTEMWEKLKPEYEKLVGEELLADLVMNSPEKVTICVTGPLSNVAWCIEKYGRRFTDKVEE 160
72386929   81 TEWRFSAKNLDDMPFLNIVEDVALWEKLKPENEAHNGQQLLADLVMKSKEKVTVCVTGPLSNMAWCIEKYGEAFTSKVEE 160
146093393  82 SDWRWSAKNMDDLPCVNIPEHVAIWEAVRDENDKLVGEEAMAQLVMSSPEKVTICVTGPLSCVAWCIGRYGEEFCKNVEE 161
154341348  82 SEWRWSAKNMDDLPCVNIPEHVTIWNSVRDQNDALVGEEVMAQLVMSSPEKVIICVTGPLSCVAWCIEKYGEEFCKNVEE 161
73537053  162 CIIMGGAVDVKGNVFIDGrTDGSAEWNIFWDPVAAKTVLTYPHLKKIVFSLDSTNSVPVTSEVVQKFGAQNKYLLSQFVG 241
71404206  161 CVIMGGAVDVGGNVFLPG-TDGTAEWNIYWDPPAAKAVLECPHIRNVLFSLNSTNAVPVCSSLVKRFGAQNEYLLSQFVG 239
71660754  161 CVIMGGAVDVGGNVFLPG-TDGTAEWNIYWDPPAAKTVLECPHIRNVLFSLNSTNTVPVCSSLVKRFGAQNEYLLSQFVG 239
72386929  161 CVIMGGAVDVGGNVFLPT-TDGSAEWNIYWDPPAAKKVLCCPNIRCVLFSLDATNTVPVRSVDVKGFGAQNQYLLSQMVG 239
146093393 162 CIIMGGAVDVKGNVFIEGrTDGSAEWNIFWDPAAAKTVLMCPHLKKIVFSLDSTNSVPVTSEVVQKFGAQNKYLLSQFIG 241
154341348 162 CVIMGGAVDVKGNVFIDGrTDGSAEWNIFWDPAAANTVLMCPHLKKIIFSLDSTNSVPVTSEVVQKFGAQNKYLLSQFVA 241
73537053  242 SAWASCTHFELIRPGDMYYAWDVLTAAYAIEQRLAELEAVPLDVVVEaNAPNEGQTRRAA-EGAAVknTYVAKNTNADMF 320
71404206  240 STWAMCTHHELLRPGDGYYAWDSLTAAYVIDNNLADLEPMTLEVEIN-KTKDEGRTFRST-QGRTC--TYVAKNTNAELF 315
71660754  240 STWAMCTHHVLLRPGDGYYAWDSLTAAYVIDNNLADLEPMALEVEIN-KTKDEGRTFRST-QGRTC--TYVAKNTNAELF 315
72386929  240 TMWAMSTHEEILRDGDAYYAWDALTAAYILEPTIATLEPVALDVDVS-KGKSEGRTPRASgEGKPC--VHVARNPSKQMF 316
146093393 242 SAWASCTHFELIRPSDGYYAWDVLTAAYAIERRLAELEAVPLEVVVEaNAPNEGQTRRAF-EGAALdhTYVAKNTKTDLF 320
154341348 242 STWASCTHVELLNPGNGYYAWDVLTAAYVIDRGLAEVEAVPLEVVVEaNAPNEGQIRRAA-DGAALrnTYLAKNTNAELF 320
73537053  321 YRMVMDTARCC 331
71404206  316 YDMVLSSMRIC 326
71660754  316 YDMVLSSMRIC 326
72386929  317 HDLVFASTRVC 327
146093393 321 YRMVMDSARCC 331
154341348 321 YRLALDSARRS 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap