Conserved Protein Domain Family
PTZ00312

?
PTZ00312: PTZ00312 
inositol-1,4,5-triphosphate 5-phosphatase; Provisional
Statistics
?
PSSM-Id: 140333
View PSSM: PTZ00312
Aligned: 6 rows
Threshold Bit Score: 592.635
Threshold Setting Gi: 157865726
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154333514   1 MDEREggdmvsssshprhrptnavqaqrrlsfegtnassnngdtngqvsgrgvDANRpsnasytgtdliseldvnadafF 80 
71658997  223 METNS------------------------------------------------DMQR----------------------F 232
71666492  219 METNS------------------------------------------------DMQR----------------------F 228
71755573  225 MRAND------------------------------------------------DEDQ----------------------F 234
146079913 229 MDEREsgdtlsssnyqrhraastvqal----rrtsfegssssnnngsanghagDAHRlsdansndtdltaeldagadayF 304
157865726 229 MDEREsgdtlssssyqrhratstvqal----rrtsfegsstsnnngnanghvgDAHRlsdansndtdltaeldadadayF 304
154333514  81 TAIGSIVFLSPRIMGIASCLSIPHRTYIPVVDDPLTYAGEAGRLFHSGKFAEAGRSRKGFLLLSLRFGTVQFNVCNVHLF 160
71658997  233 TALGSIVFLSSRMCPISSILSFRHRTFVAVADDPATYGSSPTFLFHGGKFSGAGSGRKGFLLTSLRFGTVVVNYLNVHLY 312
71666492  229 TALGSIVFLSSRMCPISSILSFRHRTFVAVADDPATYGSSPTFLFHGGKFSGAGSGRKGFLLTSLRFGTVVVNYLNVHLY 308
71755573  235 TAVGSVVYLSHRMCPISSILSFHHRTFVCVGDDPVTYGSSPTILFHGGKFSGAGESRKGYLLISLRLGTVVVNFLNVHLY 314
146079913 305 TAIGSIVFLSPRVMGIASCLSVPHRTYIPIVDDPLTYAGEAGRLFHSGKFAEAGRSRKGFLLLSLRLGTVHFNVCNVHLF 384
157865726 305 TAIGSIVFLSPRFMGIASCLSVPHRTYIPIVDDPLTYAGEAGRLFHSGKFAEAGRSRKGFLLLSLRLGTVQFNVCNVHLF 384
154333514 161 HDDDNRVALASSPSPYTGRRARAMKEAIAECSAVVDLSEPLFIFGDYNVRLDGKLLAEWVEEKMQVTVRPEKKRLRCPEH 240
71658997  313 HDSRNTDAAMTSPSLYSVQRQEALLEAMAECMVFISPEDPLFIFGDFNARLDTHNLLKHLKETQQIDVKILVKEVQAPDR 392
71666492  309 HDSRNTDAAMASPSLYSVQRQEALLEAMAECMVFISPEDPLFIFGDFNARLDTHNLLKHLKETQQIDVKILVKEVQAPDR 388
71755573  315 NDKKSKEAAAASPSPYALQRQEALLETLAECAAFISPDDPLFIFGDFNTRLDVHNMLQYLKEVENLDVKVSDGDVRAPDS 394
146079913 385 NDDDNRVALKSSPSLYTGRRARALKEAIAECSAVVDLSEPLFIFGDYNVRLDGKSFAEWVEEKMQMTVRAEKKRLRCPEQ 464
157865726 385 NDDDNRVALKSSPSLYTGRRTRAITEAIAECSAVVDLSEPLFIFGDYNVRMDGKSFTEWVEEKMQMTVRAERKRLRCPEQ 464
154333514 241 FWELFTDPDTQKELRtRFDAELQHLMNEVALLSSVELAEMPIHFAPTYFRVAHR----TPTGAAVTSAAATSAAAVATTQ 316
71658997  393 FWELFTEPQNAGMIK-KFDLELQRLMDVVAQQSGVELAEFAIRFPPTFPRIPERefakSNQKQQIEMSGGNVEASEYGVK 471
71666492  389 FWELFTEPQNAGMIK-KFDLELQRLMDVVAQQSGVELAEFAIRFPPTFPRIPERefakSNQKQQIEMSGVNVEASEYGVK 467
71755573  395 FWELFENPQHMGVIR-PYDVEVQRLLDVVAQQSGMELAEFAVRFPPTYL---------CQSPRDSEEATFQIDTPVHLVN 464
146079913 465 FWELFTDPATQQELRkRFDIEPQHLMDEVALLSSVELAEMPIQFAPTYSRVAYR----TRTGATTTSAGADAAA----LR 536
157865726 465 FWELFTNPATQQELRtRFDIEPQHLMDEVALLSSVELAEMPIQFAPTYSRVAYR----TRTGATTTSAGADAAA----LR 536
154333514 317 NVAATADTQQPTSASNDLVGRADVisveeqeqtegvrv-rpplsapplpkatLANVPLTHVTASPYRdNFCHDRLPAWCD 395
71658997  472 DDDPKLGNERRKKAARKEKGTGEA----------------------------KPSLVLPRITAIPTR-GYTRRRIPAWCD 522
71666492  468 DDDPKLGNERRKKAAGKEKGTGEA----------------------------KPSLVLPRITAIPTR-GYTRQRIPAWCD 518
71755573  465 DGEDKRES-----------GTSDRi---------------------------SVVRVLERLSSIPHH-PYGRRRVPAWCD 505
146079913 537 DVAATPDAQQQIPTSKDLAGRADAiraeeqeqaeairvrpslstplpssmspLASVPLTHVTASPHRdNFCHDRLPAWCD 616
157865726 537 DVAATPDAQQQIPTLKDLAGRADAiraeeqeqteairarpsvstllaplaspLASVPLTHVAASPYRdNFCHDRLPAWCD 616
154333514 396 RVLFNVAGLEWIAGDRARSAHPQTQAAssvlgnavsgsdglKGKQCSDQSCWHAYASIDLIHTDHDGVFILF 467
71658997  523 RVVWNPAGLELMTGQRSLPPSVSSALV--------------KSDGATDSSPRYAYRSFVLAHTDHDCVGLLF 580
71666492  519 RVVWNPAGLELMTGQRSLSPSVSSALG--------------KSDGATDSSPRYAYRSFVLAHTDHDCVALLF 576
71755573  506 RVLWNPPALELMTGRRTSQSVAGSSATa-------------HGGTGVGALRRYVYRSVALRHTDHAAVTLFF 564
146079913 617 RVMFNVAGLEWISGDRSRTAPPQPHAAssvpgsaasgagclKGRQRSGQSCWYAYAAIDLIHTDHDGVFMLF 688
157865726 617 RVMFNVAGLEWISGDRSRTAPPQPQAAssvsgsaasgagglKGRQRSGQGCWYAYAAIDFIHMDHDGVFMLF 688
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap