Conserved Protein Domain Family
PTZ00308

?
PTZ00308: PTZ00308 
ethanolamine-phosphate cytidylyltransferase; Provisional
Statistics
?
PSSM-Id: 140329
View PSSM: PTZ00308
Aligned: 7 rows
Threshold Bit Score: 605.241
Threshold Setting Gi: 167520029
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66826665    1 MSTTTNKKP--IRVYVDGCFDLMHFGHANALRQARELGDILVVGVHTDEEIAKNKGPPVMNEQERYKAVRACKWADEVAE 78 
71664619   22 TTPVPPKKPgtVRIWVDGCFDMLHFGHANALRQAAALGDELFVGCHSDAEIMQYKGPPIMHEEERYEALRACKWVDFVVE 101
74025808   24 PSPLPPKRPgtIRVWVDGCFDMLHFGHANALRQARSMGDELFVGCHTDEEIIRHKGPPSMRQEERYEALRACKWVDAVIE 103
146096338  40 TEAIPPKVPgtVRIWVDGCFDMLHFGHANALRQARRLGDELFVGCHSDEEVMRFKGPPIMHAEERYEALRACKWVDYVVE 119
154343019  41 TEEIPPKAPgtIRIWVDGCFDMLHFGHANALRQARRLGAELFVGCHSDEEVMRFKGPPMMHAEERYEALRACKWVDYVVE 120
157873807  40 TEAIPPKVPgtVRIWVDGCFDMLHFGHANALRRARRLGDELFVGCHSDEEVMRFKGPPIMHAEERYEALRACKWVDHVVE 119
167520029   5 SPKAAKRQP--TRVYADGCFDLMHFGHANALRQAKALGDILVVGIHNDEDIEKNKGPPVLTQEERYKLVKAVKWVDEVVT 82 
66826665   79 GAPYTLTEEYLDSLNCDFCVHGEDISVGADGKDVYEGIKKSGKFRFIKRTEGVSTTELVGRMLLCTKDHLqnvsgeqtsp 158
71664619  102 GYPYVTRLADMDRLEVDYVVHGDDISVDLNGHNSYQEIIDAGRFKVIKRTESISTTDLVGRMLLCNHSGA---------- 171
74025808  104 GYPYVTRVEDMKRFEVDFVVHGDDISVDLNGRNSYQAIIDAGMFKAVRRTECISTTDLVGRMLLCVPSEL---------- 173
146096338 120 NYPYCTRLKDVERLEIDYVVHGDDISVDLNGRNSYQEIIDAGKFKVVKRTEGISTTDLVGRMLLCTKNHM---------- 189
154343019 121 NYPYCTRLKDVKRFEIDYVVHGDDISVDLDGNNSYQEIIDAGKFKVVKRTEGISTTNLVGRMLLCTKDHM---------- 190
157873807 120 NYPYCTRLKDIERFEIDYVVHGDDISVDLNGRNSYQEIIDAGKFKVVKRTKGISTTDLVGRMLLCTKNHM---------- 189
167520029  83 DAPYTFNLDFLEQNNCDFVVHGDDITTNADGEDAYHIAKKSGRYKEYQRTQGVSTTDIVGRMLLMTRTHHqqd-----dg 157
66826665  159 LGGVNPNVLHKQS-PYTSLSHFLPTTRKIVQFSEGRSPKPNDKIIYMDGGFDLFHVGHTEALKQARALGDYLIVGVHDDR 237
71664619  172 LTAAENKLLEDEA-KRHAAFHYLTTSRKIAQFSNNRGPNPGDRIVYVDGSFDLFHYGHIRVLQKARELGDYVIAGVHEES 250
74025808  174 LSDADKKLLDSEV-ARKRGPHYLTTSRKIAQFSNKLAPPVGATVVYVDGAFDLFHAGHIRFLQKARALGDYLIVGIHDDQ 252
146096338 190 LKSVDEVQLESSLfEHSPTMHCLTTSRKIVQFSNNSSPKSGDRIVYVDGSFDLFHIGHIRVLQKARELGDYVIAGVYEDQ 269
154343019 191 LKSVDEVQLENCLfEEKPTMHCLTTSRKIVQFSNNSSPKSGDRIVYVDGSFDLFHIGHIRVLRKARELGDYVIVGVYEDQ 270
157873807 190 LKSVDEVQLENSLlEHSPTMPCLTTSRKIVQFSNNSSPKPGDRIVYVDGSFDLFHIGHIRVLQKARELGDYVIAGVYEDQ 269
167520029 158 DAKLSTSKLSASDsPYTGTSQLLANSKRIVQFSTQREPKDTDVIGYMPGAFDLLHTGHVAALEAARQQCDYLIVGLHTDR 237
66826665  238 VVHEQKGSNFPIMNLHERVLSVLSCRYVDEVVIGAPFSVTKDMIDSLHINVVVHGDDQVVLGPEGGVDPYKLPRELGIYK 317
71664619  251 AIRKAKGSDFPIMSLNERVLGVLSCRYVDEVVLGAPYEVTREVIESLGITVVVGGKKCDECNYEDGRDAYAVPKEMGCFY 330
74025808  253 LVRESKGEHFPIMSLNERALGVLSCRYVDDVVFGAPRGVTQEMIKILDIKIVACGTSSETRNCKGAFDVYEVPKSLNLFK 332
146096338 270 VVNEHKGKNYPIMNLNERVLGVLSCRYVDEVVMGVPFDVSKDVIDGLHINVVVGGKFSDLVVEEGGSTRYKVPKAMGIYH 349
154343019 271 VVNEQKGKNYPIMNLNERVLGVLSCRYVDEVVMGVPFDVSKEVIDELHIDVVVGGRLSDVEAGAGGSTAYEVPKAMGIYH 350
157873807 270 VVNEHKGKNYPIMSFNERVLGVLSCRYVDEVVMGVPFDVSKDVIDGLHINVVVGDKFSDLVVEEGGSTRYEVPKAMGIYH 349
167520029 238 TVNRNHGSNYPIMNLQERTLSILACRYVDDVVIGAPEAITEELLDYFKITKVFHGSTGVL--KPSGADPYQVAIDRGIFV 315
66826665  318 EVKHTEGLTATEIVKRIIDNRLQYEARNRKKEAKEINFIEQSN 360
71664619  331 EVDSECDLTTRALVDRVFKNQVAFLKRQSEKRLKEITDFECKP 373
74025808  333 VVESGSDLSTDMIVERVVKNHVVLLERQFLKHMKDSEAELRKP 375
146096338 350 EVDSGCTLSTDSLIDRVVENRLAFLKRQAEKQIKDKKSQEIKP 392
154343019 351 EVDSGCTLSTDSLIDRVVENRLAFLKRQAKKRAKDKKSQESKP 393
157873807 350 EVDSGCILSTDSLIDRVVENRLDFLKRQAEKRIKDTKSQEIKP 392
167520029 316 HVESHSDLTTEIIVDRIIKNRLNFAQRNAKKTQREVDrilrge 358
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap