Conserved Protein Domain Family
PTZ00307

?
PTZ00307: PTZ00307 
ethanolamine phosphotransferase; Provisional
Statistics
?
PSSM-Id: 140328
View PSSM: PTZ00307
Aligned: 5 rows
Threshold Bit Score: 645.738
Threshold Setting Gi: 71654658
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146105060   1 MPRKSTARHESINPLENEYIPPAYLPNLRKYKYSSTDLSIVSRYVLQRYWNFVVNLVPMTVAPNCITFTGFLIGMSSTAL 80 
71748118   17 GPGSHRSRCISLDPRVHEHIPPHFLPNLAKYKYSGSDSGIISNYVMQPYWNFIVSLVPMTVAPNAITVTGFVMCLSSALL 96 
71654658   23 GPPH--PRRISLNPIVHEHIPPDYLSNLKKYKYSGSDSSIIARYVMQPYWNFIVSLVPMTVAPNAITLTGFLIGLSSSIL 100
154346592   1 MPPKMTARRKSLNPLENEYIPPAYLPNLKKYKYSSTDFSIMSRYVLQRYWNFLVNLVPMTVAPNCITFTGFLIGMSSAVM 80 
157877757   1 MPPKSMARQESINPLENEYIPPAYLPNLRKYKYSSTDLSIVSRYVLQRYWNFVVNLVPMTIAPNCITFTGFLIGMSSTAL 80 
146105060  81 LLYYYFFEGGVYPSWCLYYAAFALFAYQTLDAIDGKQARRTGTGSPLGELFDHGCDAFLTPFVLLNVSLATYMTPVERFW 160
71748118   97 VMFFYYFGNAEYPCWVWLYAVICLFAYQTLDAIDGKQARRTNTGSPLGELFDHGCDVILTPFVQMMICCALNTPPCVTFV 176
71654658  101 VMFFFFFYDAVYPAWVWYYAAAALFIYQTLDAVDGKQARRTQTCGPLGELFDHGCDAFLTPLVQVILCCALDLPSWMTFA 180
154346592  81 LLYFFFFEEGVYPSWSLYYASFALFTYQTLDAIDGKQARRTGTGSPLGELFDHGCDAFLTPFVLLNVSLVTYMTPVERFW 160
157877757  81 LLYYYFFEEGVYPSWCLYYAAFALFAYQTLDAIDGKQARRTGTGSPLGELFDHGCDAFLTPLVLLNVSLATYMTSVERFW 160
146105060 161 LSTISSMSLFTVIWEQFSTGTFDLGYVNGPAEGIILNCVLFIVSGVYGESIWDTSAVGPYDVAyppvLSRFFPGCNGTVH 240
71748118  177 YITLSSCAVFGAIWEQFVTGTLDFGYVNGPTDGILLACGIFLITAIMSPAVWDTQVAGPYEVP----LPSWLGSCGGSFV 252
71654658  181 YSTMSSIVLFCAIWEQFSTGTLDLGYINGPTEGIFMACILFIITGLYSTSIWDTPVISPYELK----ISFFYGEVS--FV 254
154346592 161 LLSFSSFSLFTIIWEQFSTGVFVLGYVNGPTEGIILNCVLFIVSGVYGESIWDTPAVGPYDVAyppaLAWLFPGSSGVVH 240
157877757 161 LSTISSMSLFTVIWEQFSTGTFDLGYVNGPAEGIILNCVLFIVSGVYGKSIWDISAVGPYDVAyppvLSPFFPGCSGTVH 240
146105060 241 IESVRSVLFILFLVSCPFTILVNVVHAVLRPTVHASKvMPMLALAPIVTMTALAVHVFVVFPNLTVRFPFAMEISYGLLM 320
71748118  253 IGSVRSMLFTFYVVSGTLTLLTNILHVLKRPNIQKPG-MAVTTALPVVCLLVLHVWMYLVYRPIHEKYPYALELSFHVLI 331
71654658  255 IFTLRSLIFLYITVAACLTVGANIVHVVGRPGVHVKG-TPFFVMLPMLFLLFFHVCLFLTYTSIHDKYPFAFELSFGFLT 333
154346592 241 IESIRSVLFLIFLIFCLFTILTNVIHVVVRPTVHDSKvTPMLAAVPILSMTALMVHVSVVFSNLKVHFPFALEMSYGLLV 320
157877757 241 IESVRSVLFILFLISCPFTILVNVVHTVLRPTVHASKvTPMLALAPIITMTALVVHVFVVFPNLTVRFPFAMEISYGLLM 320
146105060 321 SITVTRLTLARLSAMPYRTVNWHIVFFFVaLAAASAMHYAGDAAVSHDLVETLLGWTLTGLAVFAAMQYGHMILSAFTQI 400
71748118  332 SYTATRMTVSRLCAMPFNLFSGLFIITLL-FTVAPLFIHTYLPLAEEKYVLPSLGSATVALAVLGFWQYFHMILSVITQM 410
71654658  334 SYTVTRMTVARLCAMPYSLFNAFYLITFC-VTFGALVVHAHFRQIEIKYLEPSLGSAMVALAALGVWQYLHMILSLFTQI 412
154346592 321 SITVTRLTLARLSLMPYKTTNWHIVLLFIaLTTASVLHYAGNASVPHEVVERVLGWSLTGLSVFAAVQYGHMILSAFTQI 400
157877757 321 SITVTRLTLSRLSAMPYRTVNWHIVLFFLaLAAASAMHYAGDASVSHDVVETVLGWTLTGLSVFAAMQYGHMILSAFTQI 400
146105060 401 ARYLSISIMTIKPNKSD 417
71748118  411 AYFLRISVFSITSRHDS 427
71654658  413 SYYLGVPLLSITSREEK 429
154346592 401 ARYLNISIMSIKPKKSD 417
157877757 401 ARYLSISIMTIKPNKSD 417
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap