Conserved Protein Domain Family
PTZ00306

?
PTZ00306: PTZ00306 
NADH-dependent fumarate reductase; Provisional
Statistics
?
PSSM-Id: 140327
View PSSM: PTZ00306
Aligned: 10 rows
Threshold Bit Score: 2202.66
Threshold Setting Gi: 72388944
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72547207     1 MGGCATATQRRCAATDSHTGASVVVVDPEKAARERDRIARDLLTTNFPELHVNQRWVLLYKDVMHTVPYTLTIAVDGSVA 80  
71410008    47 SPALLSQRSFFSGGADGRSSASIVVVDAELAAKERDRIAREMLSQNMPSPHAEERLVVTMRGLEHTVPYTLRIVLNGPNE 126 
71400421     1 -------------MADGRSSASVVAVDPEKAARERDEAARALLRDS----PLQTHLQYMTNGLELTVPFTLKV-VAEAVA 62  
71747118    56 PSVVSCQKRFTSHGADGISSASIVVTDPEAAAKKRDRMARELLSSNSGLCQEDEPTIINLKGLEHTIPYRLAVVLCNSRS 135 
72388944     1 -------------MVDGRSSASIVAVDPERAARERDAAARALLQDS----PLHTTMQYATSGLELTVPYALKV-VASADT 62  
72547417     1 -------------MADGKTSASVVAVDAESAAKERDAAARAMLQDG--GVSPVGKAQLLKKGLVHTVPYTLKVVVADPKE 65  
146100731    1 -------------MADGKTSASVVAVDAESAAKERDAAARAMLQDG--GVSPVGKAQLLKKGLVHTVPYTLKVVVADPKE 65  
146100590    1 MGGCATSLCRRCAATDSHTGASVVVSDPEKAARERDRIARGLLTTNFPELHVNQRSVLRYKDVMHTVPYTLTIAVDGNVA 80  
154344555    1 -------------MADGKTSASVVAVDPERAAKERDAAARAMLQDG--GVSPVGKAQLLKKGLAYAVPYTLKIVVADPKA 65  
154344505    1 MGASAMATQRRCTVSDSHTGASIVVVNPEKAARERDRIARDLLTTNFPELHVNQRSVLLYKDVVHTVPYTLSIAVDGSVT 80  
72547207    81 RQDADPVVKAILSDCFAMVDKHLNSFNPDSEVSQVNRMPVGKKHVMSEHLFEVVKCCEEVYHRSGSCFDPAAAPLVHKLR 160 
71410008   127 AKNGEVIAGKVLKEAFEVVDQHLNHYNPESEVSAINQLPLGAKHTMSQHMRRVMECCVRVYASSGACFDPATGPLVEFLR 206 
71400421    63 FSRAKEVADEVLRSAWHLADTVLNNFNPNSEISMIGRLPVGQKHTMSATLKSVITCCQHVFNSSRGVFDPATGPIIEALR 142 
71747118   136 TGEFEAKAAEILRKAFHMVDYSLNCFNPESELSRVNSLPVGEKHQMSEDLRHVMECTISVHHSSGMGFDPAAGPIISRLR 215 
72388944    63 FDRAKEVADEVLRCAWQLADTVLNSFNPNSEVSLVGRLPVGQKHQMSAPLKRVMACCQRVYNSSAGCFDPSTAPVAKALR 142 
72547417    66 MEKATADAEEVLQSAFQVVDTLLNSFNENSEVSRINRMPVGEEHQMSAALKHVMACCQKVYNSSRGAFDPAVGPLVRELR 145 
146100731   66 MEKAAADAEQVLQAAFQVVDTLLNNFNENSEVSRINRMPVGEEHQMSAALKHVMACCQKVYNSSRGAFDPAVGPLVRELR 145 
146100590   81 RQDVDPVVKAILSDCFAMVDKHLNSFNPGSEVSQVNRMPVGKKHVMSEHLFEVVKCCEEVYSSSGSCFDPAAAPLVHKLR 160 
154344555   66 MEKTTADVEKVLQTAFQVVDTLLNNFNENSEVSRINRMPVGEEHQMSAALKRVMGCCQRVYNSSRGAFDPAVGPLVRELR 145 
154344505   81 RQDADPVVKAILSNCFTMVDTHLNSFNPDSEVSKVNRMPVGEKHVMSEHLCKVVKCCEEIYNISGSCFDPAAAPLVHRLR 160 
72547207   161 DAARRQDSTEGDFAItAEEAGRFTLTNSFAIDIKEGTIARKHEDATLDLGGLNKGYTVDCVVDQLNAANFADVLFEWGGD 240 
71410008   207 SVMKDEKSDAESTLT-EEEVERFCLPQSFDVNMTDGTIARKHEGAKLDLGGVNKGYTVDRVVEKLNAAGMRDVMFEWGGD 285 
71400421   143 AKVAEKASVSDEQM--EKLFRVCNFSSSFIVDLEMGTIARKHEDARFDLGGVSKGYIVDYVVERLNAAGIVDVYFEWGGD 220 
71747118   216 GAMRDHNDMSDISVT-EAEVELFSLAQSFDVDLEEGTIARKHSEARLDLGGVNKGYTVDYVVDHLRAAGMPNVLFEWGGD 294 
72388944   143 EIALGKERNNACL---EALTQACTLPNSFVIDFEAGTISRKHEHASLDLGGVSKGYIVDYVIDNINAAGFQNVFFDWGGD 219 
72547417   146 EAAHKGKTVPAERV--NDLLSKCTLNASFSIDMNRGMIARKHADAMLDLGGVNKGYGIDYTVERLNSLGYDDVFFEWGGD 223 
146100731  146 EAAHKGKTVPAEHV--NDLLSKCTLNASFSIDMNRGMIARKHADAMLDLGGVNKGYGIDYIVERLNSLGYNDVFFEWGGD 223 
146100590  161 DAARRQDSAEGDFAIsAEEAGRFTLTNSFAIDIKEGTIARKHEDAMLDLGGLNKGYTVDCVVDRLNAANFADVLFEWGGD 240 
154344555  146 EAAREGRTLPAERI--NALLSKCTLNISFSIDLNRGTIARKHADAMLDLGGVNKGYGVDYVVEHLNNLGYDDVFFEWGGD 223 
154344505  161 NAARRQDSTEADFMItAEVAGRFTLTNSFAINVKEGTIARKHEDAMLDLGGLNKGYTVDCVVDQLNAANFSDVLFEWGGD 240 
72547207   241 CRASGVNVQRQPWAVGVVRPPSVDEIVAAAKSGKSmtmnahslgdhtdepapstlaadgaAKPAHKAFLRVMSLSNEALC 320 
71410008   286 CRATGVNYQHQPWAIAIVRPPPVEVVEQHAKEGLD-------------------------EKKEASQLLRLMYLDDEALC 340 
71400421   221 CRASGTNARRTPWMVGIIRPPSLEQLR---------------------------------NPPKDPSYIRVLPLNDEALC 267 
71747118   295 IRASGRNIKGNLWAVAIKRPPSVEEVIRRAKGKMLkmgee----------------eqeeKDDDSPSLLHVVELDDEALC 358 
72388944   220 CRASGMNARNTPWVVGITRPPSLDMLR---------------------------------NPPKEASYISVISLDNEALA 266 
72547417   224 VRASGKNQSIQPWAVGIVRPPALADIRTV-------------------------------VPKDKRSFIRVVHLNNEAIA 272 
146100731  224 VRASGKNQSNQPWAVGIVRPPALADIRTV-------------------------------VPEDKRSFIRVVRLNNEAIA 272 
146100590  241 CRASGVNVQRQPWAVGVVRPPSVDEVVAAAKSGKSvtmnahslgdhtdepaqstsaadgaAKAEHKALLRVMSLSNEALC 320 
154344555  224 VRASGKNPSNQHWVVGIARPPALADIRTV-------------------------------VPQDKQSFIRVVCLNDEAIA 272 
154344505  241 CRASGVNVQRQPWAVGVVRPPSVDEVVAASKSGKSvtmnahslgersdepaqsasaadgaAKPGHKTLLRVMSLSNEALC 320 
72547207   321 TSGDYENVLFANAlGCALSSTYNWRRRCLIEPCQNELAQVSIKCYSCLYADALATASFVKRDPVRVRYMLEPYRHDYNRV 400 
71410008   341 TSGDYENVMYSPK-YGVRSNIFDWKKRSLLEPVESELAQVSIKCYSAMYADALATASLIKRDISKVRHMLEEWRHSRNRV 419 
71400421   268 TSGDYENLTEGSN-KKLYTSIFDWKKRSLLEPVESELAQVSIRCYSAMYADALATASLIKRDIKKVRQMLEDWRHVRNRV 346 
71747118   359 TSGDYENVLYHPK-HGVAGSIFDWQRRGLLSPEEGALAQVSVKCYSAMYADALATVCLVKRDAVRIRYLLEGWRYVRSRV 437 
72388944   267 TSGDYENLIYTAD-DKPLTCTYDWKAKELMKPSQSNIAQVSVKCYSAMYADALATACFIKRDPAKVRQLLDGWRYVRDTV 345 
72547417   273 TSGDYENLIETPA-SKVYSSTFDRASKNLLEPTEAGMAQVSVKCYSCMYADALATAALLKNDPAAVRRMLDNWRYVRDTV 351 
146100731  273 TSGDYENLIEGPG-SKVYSSTFDPASKNLLEPTEADMAQVSVKCYSCMYADALATAALLKNDPAAVRRMLDNWRYVRDTV 351 
146100590  321 TSGDYENVLFANAlGCALSSTYDWRRRCLIEPCRNELAQVSIKCYSCLYADALATASFVKRDPVRVRYMLEHYRHDYNRV 400 
154344555  273 TSGDYENLVEGPG-SKVYSSTFNATSKSLLEPTETNIAQVSVKCYSCMYADALATAALLKNNPTAVRRMLDNWRYVRDTV 351 
154344505  321 TSGDYENVLFVNAlNRAVSSTYDWRHRCLIGPSQGGLAQVSVKCYSCLYADALATASFVKRNPVPIRYMLEHYRRDYNRV 400 
72547207   401 TDYAAYTREGERLAHMYEIAHESPACRIERIAGSLPARVVVIGGGLAGCAAAIEAASCGATVILLEKEARLGGNSAKATS 480 
71410008   420 TNYVTYTRQGERVARMFEIATENAEIRKNRIAGSLPARVIVVGCGLAGLSAAIEATACGAQVILLEKEPKVGGNSAKATS 499 
71400421   347 TNYVTYTRQGERVARMFEIATDNAEIRKKRIAGSLPARVIVVGGGLAGLSAAIEATACGAQVILLEKEPKVGGNSAKATS 426 
71747118   438 TNYFAYTRQGERLAHMHEIAQETRELREIRIAGSLPSRIVIVGGGLAGLSAAIEAASCGAQVILMEKEGRIGGNSAKATS 517 
72388944   346 RDYRVYVRENERVAKMFEIATEDAEMRKRRISNTLPARVIVVGGGLAGLSAAIEAAGCGAQVVLMEKEAKLGGNSAKATS 425 
72547417   352 TDYTTYTREGERVAKMLEIATEDAEMRAKRIKGSLPARVIIVGGGLAGCSAAIEAANCGAQVILLEKEPKLGGNSAKATS 431 
146100731  352 TDYTTYTREGERVAKMLEIATEDAEMRAKRIKGSLPARVIIVGGGLAGCSAAIEAANCGAQVILLEKEPKLGGNSAKATS 431 
146100590  401 TDYAAYTREGERLAHMYEIAHESPACRIERIAGSLPARVVVIGGGLAGCAAAIEAASCGATVILLEKEARLGGNSAKATS 480 
154344555  352 TDYTTYSREGERVAKMFEIATEDKEMRAKRISGSLPARVIIVGGGLAGCSAAIEAVNCGAQVILLEKEAKIGGNSAKATS 431 
154344505  401 TDYTAYTREGERLAHMYEIACESPACRTERIAGSLPARVVVIGGGLAGCAAAIEAASCGATVILLEKEARLGGNSAKATS 480 
72547207   481 GINGWGTRTQAVNHVLDNCKFFERDTFLSGKGGHCDPGLVRTLSVKSAEAISWLESFGIPLTVLYQLGGASRRRCHRAPD 560 
71410008   500 GINGWGTRAQALDDIQDNCNIFERDTHKSGLGGSTVPSLVRTLSVKSGDAISWLSSLGVPLTVLSQLGGHSRKRTHRAPD 579 
71400421   427 GINGWGTRAQAEQDVYDSGKYFERDTHKSGLGGSTDPGLVRTLSVKSGDAISWLSSLGVPLTVLSQLGGHSRKRTHRAPD 506 
71747118   518 GINGWGTRTQAKSDILDGGKYFERDTFLSGVGGTTDPALVKVLSVKSGDAIGWLTSLGVPLSVLSQLGGHSFKRTHRAPD 597 
72388944   426 GINGWGTRAQAKASIVDGGKYFERDTYKSGIGGNTDPALVKTLSMKSADAIGWLTSLGVPLTVLSQLGGHSRKRTHRAPD 505 
72547417   432 GINAWGTRAQAKQGIMDGGKFFERDTHRSGKGGNCDPCLVKTLSVKSSDAVKWLSELGVPLTVLSQLGGASRKRCHRAPD 511 
146100731  432 GINAWGTRAQAKQGVMDGGKFFERDTHRSGKGGNCDPCLVKTLSVKSSDAVKWLSELGVPLTVLSQLGGASRKRCHRAPD 511 
146100590  481 GINGWGTRTQAVNHVLDNCKFFERDTFLSGKGGHCDPGLVRTLSVKSAEAISWLESFGIPLTVLYQLGGASRRRCHRAPD 560 
154344555  432 GINAWGTRAQAKQGVMDGGKFFERDTHRSGKGGHCDPCLVKTLSVKSSDAVKWLSELGVPLTVLSQLGGASRKRCHRAPD 511 
154344505  481 GINAWGTRTQAVNHVLDNCKFFERDTFLSGKGGHCDPGLVRTLSVKSAEAISWLESFGIPLTALYQLGGASRPRCHRAPD 560 
72547207   561 QKDGTPVPVGFTIMRHLEDHIRTKLQGKVTILNEMAVVSLMHDVSAMPDGNREIRVHGVRYTSMTDASGTVMDLPADAVV 640 
71410008   580 KADGTPVPIGFTIMRTLEQHVRTKLADRVTIMESTVVTSLLNEIKGTPDGGREVRVTGVTYKKSDEKEAGSMKLTADAVI 659 
71400421   507 KADGTPVPIGFTIMQTLEQHVRTKLADRVTIMENTTVTSLLSKSRVRHDGAKQVRVYGVEVLQD---EGVVSRILADAVI 583 
71747118   598 KTDGTPLPIGHTIMRTLEDHIRNNLSERVTIMTHVSVTELLHETDTTPDGASEVRVTGVRYRDLSDVDGQPSKLLADAVV 677 
72388944   506 KKDGTPLPIGFTIMKTLEDHVRGNLSGRITIMENCSVTSLLSETKERPDGTKQIRVTGVEFTQA---GSGKTTILADAVI 582 
72547417   512 KSDGTPVPVGFTIMKTLENHIVNNLSRHVTVMTGITVTALESTSHVRPDGVLVKHVTGVRLIQA---SGQSMVLNADAVI 588 
146100731  512 KSDGTPVPVGFTIMKTLENHIVNNLSRHVTVMTGITVTALESTSRVRPDGVLVKHVTGVRLIQS---SGQSMVLNADAVV 588 
146100590  561 QKDGTPVPVGFTIMRHLEDYIRTKLQGKVTILNEMAVVSLMHDVSAMPDGNREIRVHGVRYKSMTDASGTVMDLPADAVV 640 
154344555  512 KSDGTPVPIGFTIMKTLENHIINDLSHQVTVMTGIKVTGLESTSHARPDGVLVKHVTGVRLIQG---DGQSRVLNADAVI 588 
154344505  561 QKDGSPVPIGFTIMRHLENYIHTKLQGKVTILCETAVVSLLHDVSAMPDGSREIRVRGVRYKSTSDASEAVIDLPADAVV 640 
72547207   641 LATGGFSNDRTPNSLLREYAPNVYGTPTTNGTFATGDGVKMARKLGATLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 720 
71410008   660 LATGGFSNDHMSQSLIGEFAPELSGFPTTNGPWATGDGVKLARRLGATLVDMEKVQLHPTGLIDPKDPANPTKYLGPEAL 739 
71400421   584 LATGGFSNDKTPNSLLQEFAPQLSGFPTTNGPWATGDGVKLARELGVKLVDMDKVQLHPTGLIDPKDPANPTKYLGPEAL 663 
71747118   678 LATGGFSNDREENSLLCKYAPHLASFPTTNGPWATGDGVKLATSVGAKLVDMDKVQLHPTGLIDPKDPANTTKILGPEAL 757 
72388944   583 LATGGFSNDKTADSLLREHAPHLVNFPTTNGPWATGDGVKLAQRLGAQLVDMDKVQLHPTGLINPKDPANPTKFLGPEAL 662 
72547417   589 LATGGFSNDHTPNSLLQQYAPQLSSFPTTNGVWATGDGVKMASKLGVALVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 668 
146100731  589 LATGGFSNDHTPNSLLQQYAPQLSSFPTTNGVWATGDGVKMASKLGVTLVDMDKVQLHPTGLLDPKDPSNRTKYLGPEAL 668 
146100590  641 LATGGFSNDHTPNSLLREYAPNVYGTPTTNGTFATGDGVKMARKLGATLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 720 
154344555  589 LATGGFSNDHTANSLLQQYAPQLSSFPTTNGVWATGDGVKAARELGVELVDMDKVQLHPTGLLDPKDPSNRTKYLGPEAL 668 
154344505  641 LATGGFSNDQTVNSLLREYAPNVYGTPTTNGAFATGDGVKMARQLGARLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 720 
72547207   721 RGSGGILLNKNGERFVNELDLRSVVSQAIIAQDNEYPNSGGSKFAYCVLNEEAATLFGKNSLTYYWKSQGLFTRVDDMKA 800 
71410008   740 RGSGGVLLNKKGERFVNELELRSVVSNAIIEQGDEYPYSGGSKFAFCVLNDAAVKLFGVNLLNFYANTLGVFKRVDDLQG 819 
71400421   664 RGSGGVLLNKKGERFVNELDLRSVVSNAIIEQGDEYPDAGGSKFAFCVLNDAAVKLFGVNSHGFYWKRLGLFVKADTVEK 743 
71747118   758 RGSGGILLNKQGKRFVNELDLRSVVSKAINTQGNEYPGSGGCYFAYCVLNEDATNLFGGGALGFYGKKLGLFQRAETVEE 837 
72388944   663 RGSGGVLLNKQGKRFVNELDLRSVVSKAIMEQGAEYPGSGGSMFAYCVLNAAAQKLFGVSSHEFYWKKMGLFVKADTMRD 742 
72547417   669 RGSGGVLLNKNGERFVNELDLRSVVSQAIIAQDNVYPGSGGSKFAYCVLNETAAKLFGKNFLGFYWNRLGLFQKSDSVAG 748 
146100731  669 RGSGGVLLNKNGERFVNELDLRSVVSQAIIAQDNVYPGSGGSKFAYCVLNETAAKLFGKNFLGFYWNRLGLFQKVDSVAG 748 
146100590  721 RGSGGILLNKNGERFVNELDLRSVVSQAIIAQDNEYPNSGGSKFAYCVLSEEAATLFGKNSLTYYWKSQGLFTRVDDMKA 800 
154344555  669 RGSGGVLLNKNGERFVNELDLRSVVSQAIIEQNNVYPGSGGSKFAYCVLNEAAAKLFGKNFLGFYWHRLGLFEKVEDVAG 748 
154344505  721 RGSGGILLNRNGERFVNELDLRSVVSQAINAQDDEYPNSGGSKFAYCVLSEEAAKLFGKNALTYYWKSQGLFTRVDNIKA 800 
72547207   801 LAELIGCSVESLHRTLETYERQSTGK-KACPLTGKLVFPSVVGTKGPYYVAYVTPSIHYTMGGCFISPAAELLMEDHSV- 878 
71410008   820 LAMLIGCDVLTLQNTLETYESSSIVT-SACPFTGKVVYPCVVGPQGPFYVAFVTPSIHYTMGGCLISPSAEIQREHYSL- 897 
71400421   744 LAALIGCPVENVRNTLGDYEQLSKEN-RQCPKTRKVVYPCVVGPQGPFYVAFVTPSIHYTMGGCLISPSAEMQLEENTT- 821 
71747118   838 LAKLIGCDEGELRDTLEKYETCSKAK-VACPVTGKVVFPCVVGTRGPYNVAFVTPSIHYTMGGCLISPAAEVLQEYKGL- 915 
72388944   743 LAALIGCPVESVQQTLEEYERLSTSQ-RSCPITRKSVYPCVLGTKGPYYVAFVTPSIHYTMGGCLISPSAEIQMKNTSSr 821 
72547417   749 LAKLIGCPEANVMATLKQYEELSSKKlNPCPLTGKNVFPCVLGTQGPYYVALITPSIHYTMGGCLISPSAEMQTKDNS-- 826 
146100731  749 LAKLIGCPEANVMATLKQYEELSSKKlNPCPLTGKNVFPCVLGTQGPYYVALVTPSIHYTMGGCLISPSAEMQTIDNS-- 826 
146100590  801 LAELIGCSVESLHRTLETYERQSTGK-KACPRTGKLVFPSVVGTKGPYYVAYVTPSIHYTMGGCFISPAAELLMEDHSV- 878 
154344555  749 LAKLIGCPEENVTATLKEYKELSSKKlHACPLTNKNVFPCTLGTEGPYYVAFVTPSIHYTMGGCLISPSAEMQTIDNT-- 826 
154344505  801 LAELIGCSVDNLHRTLETYEHQSTAK-VACPLTGKLVFPSVVGTSGPYYVAYVTPSIHYTMGGCSISPAAELLMEDHSV- 878 
72547207   879 NIFDDMRPILGLFGAGEVTGGVHGRNRLGGNSLLECVVFGKIAGDRAATILQKEKHGLSKDKWVPVVVRESRASDQFGVG 958 
71410008   898 NLLENQRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKQVYALSKDKWTSVVVRESRSGERFGTG 977 
71400421   822 SPFGHRRPIFGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKKPVPLSFKTWTTVILREVREGGMYGTG 901 
71747118   916 NILENHRPIRCLFGAGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKREIALSKTSWTSVVVRESRSGEQFGTG 995 
72388944   822 APLSHSNPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRASTILQRKSSALSFKVWTTVVLREVREGGVYGAG 901 
72547417   827 GVTPVRRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKKNTGLSMTEWSTVVLREVREGGVYGAG 906 
146100731  827 GVTPVRRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKKSTGLSTTEWSTVVLREVREGGVYGAG 906 
146100590  879 NIFEDMHPILGLFGAGEVTGGVHGRNRLGGNSLLECVVFGKIAGDRAATILQKEKHGLRKDKWVPVVVRESRASDQFGVG 958 
154344555  827 GVTPVRRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKKNAGLSMTEWSTVVLREVREGGVYGTG 906 
154344505  879 NIFEDMRPILGLFGAGEVTGGVHGRNRLGGNSLLECVVFGKIAGDRAATILQKEKYGLSKDKWVPVVVRETRASDQFGVG 958 
72547207   959 SRVLRFNLPGATQTSGLTVGEFIGIRGDWDGQQLIGYYSPINMPDDKGRISILARGDKGNLQEWISSMRPGDSVEMKACG 1038
71410008   978 SRVLRFNLPGALQRSGLYLGQFIAIRGEWDGQQLIGYYSPITLPDERGVISILARGDKGTLKEWISAMRPGDSVEIKSCG 1057
71400421   902 SRVLRFNLPGALQRSGLQLGQFIAIRGEWDGQQLIGYYSPITLPDDLGVIGILARSDKGTLKEWISALEPGDAVEMKGCG 981 
71747118   996 SRVLRFNLPGALQRTGLNLGEFVAIRGEWDGQQLVGYFSPITLPEDLGTISLLVRADKGTLKEWICALRPGDSVEIKACG 1075
72388944   902 SRVLRFNLPGALQRSGLSLGQFIAIRGDWDGQQLIGYYSPITLPDDLGMIDILARSDKGTLREWISALEPGDAVEMKACG 981 
72547417   907 SRVLRFNMPGALQKTGLALGQFIGIRGDWDGHRLIGYYSPITLPDDVGVIGILARADKGRLAEWISALQPGDAVEMKACG 986 
146100731  907 SRVLRFNMPGALQRTGLALGQFIGIRGDWDGHRLIGYYSPITLPDDVGVIGILARADKGRLAEWISALQPGDAVEMKACG 986 
146100590  959 SRVLRFNLPGATQTSGLTVGEFIGIRGDWDGQQLIGYYSPINMPDDKGRISILARGDKGNLQEWISSMRPGDSVEMKACG 1038
154344555  907 SRVLRFNMPGALQKTGLALGQFIAMRGDWDGQQLLGYYSPITLPDDIGVIGILARADKGRLAEWISALQPGDAVEMKACG 986 
154344505  959 SRVLHFNLPGATQTSGLTVGEFISIRGDWDGQHLIGYYSPISMPDDKGRISILARGDKGNLQEWVSSMRPGDSVEMKACG 1038
72547207  1039 GLRIELKPHQKQMVYRKTVIRKLGLIAGGSGVAPMLQIIKAALNRPYVDSIETIRLVYAAEDEYELTYRLLLKQYRTD-N 1117
71410008  1058 GILIERNPAKKQFLFHGHVIRQFGLIAGGSGVAPMLQIIRAALERPYVDTTESIRLVYTAEEYEELTYRELLHHYSKE-N 1136
71400421   982 GLVIERRFSERYLYFSGHALKKLCLIAGGTGVAPMLQIIRAALKKPFLENIESIRLIYAAEDVSELTYRELLEHHQRD-S 1060
71747118  1076 GLRIDQDPVKKCLLFRNRPITRFALVAAGTGVAPMLQVIRAALKKPYVDTLESIRLIYAAEEYDTLTYRSILQRFAEE-F 1154
72388944   982 GLVIERRLSDKHFVFMGHIINKLCLIAGGTGVAPMLQIIKAAFMKPFIDTLESVHLIYAAEDVTELTYREVLEERRRE-S 1060
72547417   987 GLIIERRFADRHFFFRGHKIRKLALIGGGTGVAPMLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEyG 1066
146100731  987 GLIIERRFADRHFFFRGHKIRKLALIGGGTGVAPMLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEyG 1066
146100590 1039 GLRIELKPHQKQMVYRKTVIRKLGLIAGGSGVAPMLQIIKAALNRPYVDSIETIRLVYAAEDEYELTYRSLLKQYRAD-N 1117
154344555  987 GLIIHRRFAARHLFFRSHKIRKLALIGGGTGVAPMLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEyG 1066
154344505 1039 GLRIELKPQQKQMIYRKTVIRKLALIAGGSGVAPMLQIIKAALSRPYVDSIETIRLVYAAEDEYELTYRSLLKKYRTD-N 1117
72547207  1118 PGKFDCGFVLNNPPEGWTEGVGYVDRATLQSLLPPPSKGLLVAICGPPVMQRSVVADLLALGYNAEMVRTVDEDGAL 1194
71410008  1137 PDKFSVEFSLNNPPEGWTGGVGFVDRPSLRKTLQPPSNDLLIAICGPPAMQRAMKNDLLAMGYNPALVHTVDDDMQA 1213
71400421  1061 KGKFRSIFVLNRPPPIWTDGVGFIDKKLLSSSVQPPAKDLLVAICGPPIMQRVVKTCLKSLGYDMQLVRTVDEVETQ 1137
71747118  1155 PDKFVCNFVLNNPPEGWTGGVGFVNKKSLQKVLQPPSSEPLIVVCGPPVMQRDVKNELLSMGYDKELVHTVDGESGT 1231
72388944  1061 RGKFKKTFVLNRPPPLWTDGVGFIDRGILTNHVQPPSDNLLVAICGPPVMQRIVKATLKTLGYNMNLVRTVDETEPS 1137
72547417  1067 SEKFKCHFVLNNPPAQWTDGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKGALKSLGYNMNLVRTVDETEPT 1143
146100731 1067 SEKFKCHFVLNNPPAQWTDGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKGALKGLGYNMNLVRTVDETEPT 1143
146100590 1118 PDKFDCGFVLNNPPEGWTEGVGYVDRATLQSLLPPPSKGLLVAICGPPVMQRSVVADLLALGYNAEMVRTVDEDGAL 1194
154344555 1067 SGKFKCHFVLNNPPSQWTEGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKSALKGLGYNMNLVRTVDEPEPL 1143
154344505 1118 TEKFDCDFVLNNPPEGWTEGVGYVDRATLQSFLPPPSKGLLVAICGPPVMQHSVVADLLALGYSAETVRTIDEDRML 1194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap