Conserved Protein Domain Family
PTZ00305

?
PTZ00305: PTZ00305 
NADH:ubiquinone oxidoreductase; Provisional
Statistics
?
PSSM-Id: 140326
View PSSM: PTZ00305
Aligned: 6 rows
Threshold Bit Score: 553.106
Threshold Setting Gi: 154335671
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71404346    1 MKRLAARFPLWYAAPPLLMARRFFKSDGTPYNSDMTDTLHGSEYVHRGGVEAIVEGVAAGQYAEHKPRAIMFVNKRPVEI 80 
71652845    1 MKRLAARFPLWYAAPSLLMARRFFKSDGTPYNSDMTDTLHGSEYVHRGGVEAIVEGVAAGQYAEHKPRAIMFVNKRPVEI 80 
71748808    1 MRRFSNCLLCFGAITPVGDSKRFFKSDGTPYNRDAANNLYGSEHTHRGGVEALSEGVAAGQYGEHKPRAIMFVNKRPVEI 80 
146084210   1 ----------------------------------MTDIAHGSRYNRDAAASTAAEQVAAGQYAENKPRAIMFVNKRPVEI 46 
154335671   1 ----------------------------------MTDIAHGSTYNRRAAVNTAAEQVAAGQYAENKPRAIMFVNKRPVEI 46 
157868007   1 ----------------------------------MTDIAHGSRYDRDAAISTAAEQVAAGQYAENKPRAIMFVNKRPVEI 46 
71404346   81 IPQEENLLEVLEREGIRVPKFCYHPILSVAGNCRMCLVQVDGTQNLVVSCATVALPGMSIITDSRLVRDAREGNVELILI 160
71652845   81 IPQEENLLEVLEREGIRVPKFCYHPILSVAGNCRMCLVQVDGTQNLVVSCATVALPGMSIITDSRLVRDAREGNVELILI 160
71748808   81 IPQEENLLEVLEREGIRVPKFCYHPILSVAGNCRMCLVQVDGTQNLVVSCATVALPGMSIITDSRLVRDAREGNVELILI 160
146084210  47 IPQEENVLEVLEREGITVPKFCYHPILSVAGNCRMCMVQVDGTQNIVVACSTVALPGMSIITDSRLVRDAREGNVELILI 126
154335671  47 IPQEENVLEVLEREGITMPKFCYHPILSVAGNCRMCMVQVDGTQNIIVACSTVALPGMSIITDSRLVRDAREGNVELILI 126
157868007  47 IPQEENVLEVLEREGITVPKFCYHPILSVAGNCRMCMVQVDGTQNIVVACSTVALPGMSIITDSRLVRDAREGNVELILI 126
71404346  161 NHPNDCPICEQATNCDLQNISMNYGTDIPRYKEDKRAVQDFYFDPQTRVVLNRCIHCTRCVRFLNEHAQDFNLGMIGRGG 240
71652845  161 NHPNDCPICEQATNCDLQNISMNYGTDIPRYKEDKRAVQDFYFDPQTRVVLNRCIHCTRCVRFLNEHAQDFNLGMIGRGG 240
71748808  161 NHPNDCPICEQATNCDLQNVSMNYGTDIPRYKEDKRAVQDFYFDPQTRVVLNRCIHCTRCVRFLNEHAQDFNLGMIGRGG 240
146084210 127 NHPNDCPICEQATNCDLQNVSMNYGTDIPRYREDKKAVEDFYFDPQTRVVLNRCIHCTRCIRFLNEHAQDFNLGQIGRGG 206
154335671 127 NHPNDCPICEQATNCDLQNVSMNYGTDIPRYREDKKAVEDFYFDPQTRVVLNRCIHCTRCIRFLNEHAQDFNLGQIGRGG 206
157868007 127 NHPNDCPICEQATNCDLQNVSMNYGTDIPRYREDKKAVEDFYFDPQTRVVLNRCIHCTRCIRFLNEHAQDFNLGQIGRGG 206
71404346  241 LSEISTFLDELEVKTDNNMPVSQLCPVGKLYLGDADENNAVADELDASEQAYAVATS 297
71652845  241 LSEISTFLDELEVKTDNNMPVSQLCPVGKLYLGDADENNAVADELDACEQAHAVATS 297
71748808  241 LSEISTFLDELEVKTDNNMPVSQLCPVGKIYLGDADENNLIAEQLDVSYESECGDRG 297
146084210 207 LSEISTFLDELEVKTDNNMPVSQLCPVGKLYMGDADENNDIVRTLEAAGATA----- 258
154335671 207 LSEISTFLDELEVKTDNNMPVSQLCPVGKLYMGDADENNEILRELEAAEVTA----- 258
157868007 207 LSEISTFLDELEVKTDNNMPVSQLCPVGKLYMGDADENNDIVRELEAAGATA----- 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap