Conserved Protein Domain Family
PTZ00303

?
PTZ00303: PTZ00303 
phosphatidylinositol kinase; Provisional
Statistics
?
PSSM-Id: 140324
View PSSM: PTZ00303
Aligned: 3 rows
Threshold Bit Score: 2450.65
Threshold Setting Gi: 154335222
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146093838    1 MSDAAAATAAAEAATTARTENPVAVCPATPPPTNCIGSVWLGVYDRVSHTRFRIHIEDPVFLCILSNAVVPAAESDGSLP 80  
154335222    1 MADLLAATAAADVTTPGRTENPVTVSPPTPPPTSCIGSVWLGVYDRVSHTRFRIHVEDPIFICILSNTVVPVAESDGSLP 80  
157872487    1 MSDAPAATAAAEAATTARTENPVAVCPATPPPTNCIGSVWLGVYDRVSHTRFRIHIEDPVFLCIVSNTVVPAAESDGSLP 80  
146093838   81 FEIQEFVEYLDAYERERLRQAYAARRGPN--------------TSGGAVGSGRCGVHGDPAAAAATAGSCGAGGAVSGSG 146 
154335222   81 FEMLEFVEYLDAYERERLRQAYAARRGANsgsftainsgvnavSSSGTAGSGRSGAHGDTAVAATAAGSCGAGGVGLGSS 160 
157872487   81 FEMQEFVECLDAYERERLRQAYAARRGTN--------------TSGGGVGIGRCGVHGDPAAAAATAGSCGAGGAVSGSG 146 
146093838  147 AIYSGVSGIPSMCCLNScspaGGPVPRKLEEALRETLSENSDFFFRVSSVAYHLDPNPQGASACTSASASAGSGVMGNAG 226 
154335222  161 AVHSGVSGIPSSGGLNS----GAPVPRKLEETLRETLSENSDFFFRVSSVAYHLDPNTQGASACTAASAGAASGVIGNVG 236 
157872487  147 AIHSGVFGIPPMCCLNScspaGGPVPRKLEETLRETLSENSDFFFRVSSVAYHLDPNPQGASACTPASASVGSGVMGNAG 226 
146093838  227 VGARSPRRGEGLASAAAGGVASLLTNTIAAASATGPPPRRNYSVHSGYSAAFHLCGRLFADVYRDHCRALAQKIASGFSG 306 
154335222  237 VGTRVPSRGEGRASAAAGGVASLFTNTIAAASATGPPPRRNYSVHSGYSAAFHLCGRLFADVYTDHCRTLAQKIACGFSA 316 
157872487  227 VGACSPRRGEGLASAAAGGVASLLSNTIAAASATGPPPRRKYSVHSGYSAAFHLCGRLFADVYRDHCRALAQKIASGFSG 306 
146093838  307 LRVEDCVKFRKAVWSGFHLKALEPYRSGARSESNLELRWVSEKIKDDQHLFPSRGVAPQQQSSHVSRLVDATLSYVANAR 386 
154335222  317 LHVEDCVKFRKAVWSGFHLKALEPYRSGARSESNLELRWVSEKIRDDQHLFPSRSVAPQQQSSDASRLVDATLSYVANAR 396 
157872487  307 LRVEDCVKFRKAVWSGFHLKALEPYRSGARSESNLELRWVSEKIKDDQHLFPSRGVAPQQESSHVSRLVDATLSYVANAR 386 
146093838  387 LRGRPSSSVGGNANSSTGGNGAAGAGGAGAAGKGGGSAAARATVGGVAEENELNTFGLTKLLHNPSWQKDDESSDSCPSC 466 
154335222  397 LRVRPGSGIGGIASGSTGSSGTAGASGGGAAGKGSGGAAARAAVGSDAEENELNTFGLTKMLHNPSWQKDDESSDSCPSC 476 
157872487  387 LRGRPSSSIGGNANSSTGGNGAAGAGGAGAAGKGGGSAAARATVGGVAEENELNTFGLTKLLHNPSWQKDDESSDSCPSC 466 
146093838  467 GRAFISLSRPLGTRAHHCRSCGIRLCVFCITKRAHYSFAKLAKPGSSDEAEERLVCDTCYKEYETVSQLHYLGALFAFAG 546 
154335222  477 GRVFVSLSRPLGTRAHHCRSCGVRLCVFCITKRAHYSFAKLAKPGSSDEAEERLVCDTCYREYETVSQLHYLGALFAFAG 556 
157872487  467 GRAFISLSRPLGTRAHHCRSCGIRLCVFCITRRAHYSFAKLAKPGSSDEAEERLVCDTCYKEYETVSQLHYLGALFAFAG 546 
146093838  547 LGFSDLVLCRTVNEQWREAAELCISEYRLLLHNCDADLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLLKF 626 
154335222  557 LGFSDLVLCRTVNEQWREAAELCISEYRLLLHNCDADLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLLKF 636 
157872487  547 LGFSDLVLCRTVNEQWREAAELCISEYRLLLHNCDANLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLLKF 626 
146093838  627 IATENLWVPDASYYFIWRLSSSVLNRADTVLTSLPSLSSSAASAVESKHHSFQLPVVPNFSHWHLFCTAFCSKIGSSYFF 706 
154335222  637 IATENLWVPDASYYFIWRLSSSVLNRADTVLTTLPSLSSSVAPVVESKHRSFQLPVVPNFSHWHLFCTAFCSKIGASYFF 716 
157872487  627 IATENLWVPDASYYFIWRLSSSVLNRADTVLTSLPSLSSSAASAVESKHHSFQLPVVPNFSHWHLFCTAFCSKIGSSYFF 706 
146093838  707 VKCAELLCAAPTKVYDAYVASALERMTRVYLSTTALWKRLAEANQATAASFAAWTSSPPTTAPLPLPMLSDVTEGQVVTV 786 
154335222  717 VKCAELLCAAPAKVYDAYVASALERMTRVYLSTTPLWKRLAEANQATVAVFTARTSSPPTTTPLPLPTLSDVTEGQVVTV 796 
157872487  707 VKCAELLCAAPAKVYDAYVASALERMTRVYLSTTPLWKRLAEANQATAAAFAARTSSPPTTAPLPLPMLSDVTEGQVVTV 786 
146093838  787 WLLDMLHKDALVPAQRRRFQQLLEQVIPTVAGSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEVGRKDPVARDR 866 
154335222  797 WLLDMLHKDALVPTQRRRFQQVLERVIPVVANSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEVGRKDPAARDR 876 
157872487  787 WLLDMLHKDALVPAQRRRFQQLLEHVIPTVAGSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEVGRKDPVARDR 866 
146093838  867 VVATLDFFHELDRFCAQSSVVSQTSVVGWIVAYCRRCTPKAPASATGAPGEATTPSARRGYHHSYIDLPHPILNPFKPYI 946 
154335222  877 VLATLDFFNELDRFCAQSSVVNQTSVVGWIVAYCRRGAPKVSASATGAKEEAVAPSARRIYQQSHIDLPHPILNPFKPYI 956 
157872487  867 VVATLDFFHELDGFCAQSSVVSQTSVVGWIVAYCRRGAPKAPASATGAPGEATMPSARRVYHHSYIDLPHPILNPFKPYI 946 
146093838  947 VLKSIRLSGVKVAPNAASKPTWLAFSTWSAAEHLERDTKTAAKNFGGHTLPTGESHAERSGEGREKGT-GAAPTYPSTKT 1025
154335222  957 MLKSIRLSGIKVAPNAASKPTWLAFSTWSAAEHLAHDAMNPVNNFGARTALTGVSHAEKSVEGRAKGTeGGPKPCTAHIT 1036
157872487  947 VLKSIRLSGVKVAPNAASKPTWLAFSTWSAAEHLERDTTTAAENFGRHTLPTGESHAERSGEGREKGT-GAASTYLSTKT 1025
146093838 1026 SAPVTSPVAAVNGVSPELLHDSLPQECMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEMLDYSVLPLSCDSGLIEKA 1105
154335222 1037 SATVTSSVTTVRGVSPASRYDSLPQECMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEMLDYSVLPLSCDSGLIEKA 1116
157872487 1026 SAPVTRPVTAVNGVSPEALHESLPQEYMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEMLDYSVLPLSCDSGLIEKA 1105
146093838 1106 EGRELSNLDNMDIASYVLQRGTRSCINFLASAKLFLLLNYIFSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLAR 1185
154335222 1117 EGRELSNLDNMDITSYVLYRGTQGCINFLASAKLFLLLNYIFSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLAR 1196
157872487 1106 EGRELSNLDNMDIASYVLHRGTRSCINFLASAKLFLLLNYIFSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLAR 1185
146093838 1186 STVRIDDAFLAAVEQCQQRQCPCFAGPSPAAASSYARGCTSPPGSPGSGGCGSSASPTKAPEPSSAEIREAFFSSAAEWF 1265
154335222 1197 STVRIDDAFLAAVEQCQQRQGSAKCEPSTVATSSRPRGCASLPGASGGGGCVLPANPVRAPEPSSAEIRAAFFSSAAEWF 1276
157872487 1186 STVRIDDAFLAAVEQCQQRQCSCFAGSSPAATSSHAQGWASPPASSGSGGRGSCASPTKAPEPSSAEIREAFFSSAAEWF 1265
146093838 1266 VHVRPFAAVFYELWLYAVHRHTVPYNDAEMLNMLNTLFDRHASQTSSASKFSTTMKESVNVCRLKDVTHSSAEVLRTFAD 1345
154335222 1277 VHVRPFAAVFYELWLYAVHRHTVPYNDGEMLNMLNTLFDRHASQTSSACKFSTTMTESVNVCRLKDVTHSSAEVLRTFAD 1356
157872487 1266 VHVRPFAAVFYELWLYAVHRHTVPYNDAEMLNMLNTLFDRHASQTSSASKFSTTMKESVNVCRLKDVTHSSAEVLRTFAD 1345
146093838 1346 QVSRRVSESSVDAMKMMGSMWSSWWSRGG 1374
154335222 1357 QVSRRVSESSVDAVKMMGSMWSSWWSRGR 1385
157872487 1346 QVSRRVSESSVDAMKMMGSMWSSWWSRGG 1374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap