Conserved Protein Domain Family
PTZ00301

?
PTZ00301: PTZ00301 
uridine kinase; Provisional
Statistics
?
PSSM-Id: 140322
View PSSM: PTZ00301
Aligned: 3 rows
Threshold Bit Score: 384.353
Threshold Setting Gi: 157873450
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157873450   1 MRSPSVSSQRSAAVSESSchhlyhvqgdvrslvvttpwrsamIQPPFLPQHMCRSlestykhasllftggdshgvcrarq 80 
154342648   1 MPCTVIGISGASGSGKSS------------------------LSTNIVSELMAHC------------------------- 31 
154342640   1 MPCTVIGISGASGSGKSS------------------------LSTNIVSELMAHC------------------------- 31 
157873450  81 llrlglrqvvaerahrigahpgdrGPNRSGIFCEELYHRDESNVPEGEHPSTDYSHPKSLEQELRATHVFELRAGKRVQV 160
154342648  32 ------------------------GPVSIGVICEDFYYRDQSNIPESERAYTNYDHPKSLEHDLLTTHLRELKSGKTVQI 87 
154342640  32 ------------------------GPVSIGVICEDFYYRDQSNIPESERAYTNYDHPKSLEHDLLTTHLRELKSGKTVQI 87 
157873450 161 PPYDYVRHARSGNTVTTTPTRIIMVEGILLFTNAELCKAMDCLIFVGTPLDICLIRRAERDAKERGHTFKAAIEQYATTV 240
154342648  88 PQYDYVHHTRSDTAVTMTPKSVLIVEGILLFTNAELRNEMDCLIFVDTPLDICLIRRAKRDMRERGRTFESVVEQYEATV 167
154342640  88 PQYDYVHHTRSDTAVTMTPKSVLIVEGILLFTNAELRNEMDCLIFVDTPLDICLIRRAKRDMRERGRTFESVIEQYEATV 167
157873450 241 RRVHCAYAELSKVHVDISAPCWKNSGVAFGVLRVKQSHVLPlphhrknvmrchrsaefdcalGL 304
154342648 168 RPMYYAYVEPSKVYADIIVPSWKDNSVAVGVLRAKLNHDLE---------------------NM 210
154342640 168 RPMYYAYVEPSKVYADIIVPSWKDNSVAVGVLRAKLNHDLE---------------------NM 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap