Conserved Protein Domain Family
PTZ00300

?
PTZ00300: PTZ00300 
pyruvate kinase; Provisional
Statistics
?
PSSM-Id: 140321
View PSSM: PTZ00300
Aligned: 9 rows
Threshold Bit Score: 905.192
Threshold Setting Gi: 154344359
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71419545   46 MSVARMNFSHGSHEYHQTTINNLRAAATELGAHIGLALDTKGPEIRTGLFKDGGIALAPGDTVLVTSDPAFEKIGTKEKF 125
71667353   46 MSVARMNFSHGSHEYHQTTINNLRAAATEIGAHIGLALDTKGPEIRTGLFKDGGIALAPGDTVLVTSDPAFEKIGTKEKF 125
72546713    1 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 80 
72546717   46 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 125
146100263  54 MSVARMNFSHGSHEYHRTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 133
146100276   1 MSVARMNFSHGSHEYHRTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 80 
154344357   1 MSVVRMDFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCYVTTDPAFSDKGTKDKF 80 
154344359   1 MSVARKNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCCVTTDPAFSGKGTKDKF 80 
154344353   1 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCYVTTDPAFSDKGTKDKF 80 
71419545  126 YIEYPRLSITVRPGGFIYIDDGVLSLKVLSKEDEYTLKCYVNNAHFLTDRKGCNLPGCEVDLPAVSEKDREDLKFGVEQG 205
71667353  126 YIEYPRLSITVRPGGFIYIDDGVLSLKVLSKEDDYTLKCYVNNAHFLTDRKGCNLPGCEVDLPAVSEKDREDLKFGVEQG 205
72546713   81 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRCGVNLPGCDVDLPAVSAKDCADLQFGVEQG 160
72546717  126 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQG 205
146100263 134 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQG 213
146100276  81 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQG 160
154344357  81 YIDYANLPKVVSPGGYIYIDDGILILQVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQG 160
154344359  81 YIDYANLPKVVSPGGYIYIDDGILILQVQSHEDEQTLKCTVTNAYTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQG 160
154344353  81 YIDYANLPKVVSPGGYIYIDDGILILQVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQG 160
71419545  206 IDMVFASFIRTAEQVQEVREALGEKGKDILIISKIENHQGVQNIDGIIEASDGIMVARGDLGVEIPAEKVVVAQMILISK 285
71667353  206 IDMVFASFIRTAEQVQEVREALGEKGKDILIISKIENHQGVQNIDAIIEASDGIMVARGDLGVEIPAEKVVVAQMILISK 285
72546713  161 VDMIFASFIRSAEQVGDVRKALGAKGHDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
72546717  206 VDMIFASFIRSAEQVGDVRKALGAKGHDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 285
146100263 214 VDMIFASFIRSAEQVGEVREALGAKGRDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 293
146100276 161 VDMIFASFIRSAEQVGEVREALGAKGRDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
154344357 161 VDIIFASFIRSAEQVVEVRKALGAKGGDIMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
154344359 161 VDIIFASFIRSAEQVVEVRKALGAKGGDIMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
154344353 161 VDIIFASFIRSAEQVVEVRKALGAKGGDIMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
71419545  286 CNVAGKPVICATQMLESMTTNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSATNQAVMFN 365
71667353  286 CNVAGKPVICATQMLESMTTNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSATNQAVMFN 365
72546713  241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 320
72546717  286 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 365
146100263 294 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 373
146100276 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 320
154344357 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQSAINEYVFFN 320
154344359 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQSAINEYVFFN 320
154344353 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQSAINEYVFFN 320
71419545  366 SIKKMQKLPMSPEEAVCSSAVNSVYEVRAKALLVLSNSGRSARLASKYRPDCPIICATTRMRTCRQLTITRSVDAVFYDA 445
71667353  366 SIKKMQKLPMSPEEAVCSSAVNSVYEVRAKALLVLSNSGRSARLASKYRPDCPIICATTRMRTCRQLTITRSVDVVFYDA 445
72546713  321 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
72546717  366 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 445
146100263 374 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 453
146100276 321 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
154344357 321 SIKKLQPIPMSVEEAVCSSAVNSVYETKAKALVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
154344359 321 SIKKLQPIPMSVEEAVCSSAVNSVYETKAKALAVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
154344353 321 SIKKLQPIPMSVEEAVCSSAVNSVYETKAKALVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
71419545  446 ERYGEDENKEKRVQLGVDCAKKKGYVVPGDLMVVVHADHKVKGYPNQTRIIYVS 499
71667353  446 ERYGEDENKEKRVQLGVDCARKKGYVVPGDLMVVVHADHKVKGYPNQTRIVYVS 499
72546713  401 EKLGHDEGKEQRVAMGVGFAKSKGYEQSGAVVFMIDIFQSKGIDVMRSTIIVGK 454
72546717  446 EKLGHDEGKEQRVAMGVGFAKSKGYVQTGDYSVVIHADHKVKGYANQTRILLVE 499
146100263 454 EKLGHDEGKEQRVAMGVGFATSKGYVQTGDYCVVIHADHKVKGYANQTRILLVE 507
146100276 401 EKLGHDEGKEQRVAMGVGFATSKGYKLSGALVAIVDILRWWGCRVGQSTIIERK 454
154344357 401 DRLGHDEGKEDRVATGVEFAKSRG------------------------------ 424
154344359 401 DRLGHDEGKEDRVATGVEFAKSRD------------------------------ 424
154344353 401 DRLGHDEGKEDRVATGVEFAKSRGFVQSGDSCVVVHADHKVKGYANQTRILLVS 454
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap