Conserved Protein Domain Family
PTZ00297

?
PTZ00297: PTZ00297 
pantothenate kinase; Provisional
Statistics
?
PSSM-Id: 140318
View PSSM: PTZ00297
Aligned: 7 rows
Threshold Bit Score: 2752.8
Threshold Setting Gi: 71755785
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146095976    1 MSASDIGCASARVLSYNFNILPRGSGGYQHERIETFLASVDAYDVVLLQEVYATSYFPYVMQKQLCYQKMLLDGLKAKGF 80  
71653816    28 TPNMEAGSMQVRALSYNFNILPRGCGGFQNERIDNFLKCVNEYDVLLFQEVYAASVLPYFVQKHICFQKRLVDELKERGF 107 
71650128    28 TPNMEAGSTQVRALSYNFNILPRGCGGFQNERIDNFLKCVNEYDVLLFQEVYAASVLPYFVQKHICFQKRLVDELKERGF 107 
71755785    25 IAVATATNAQLRVLSYNFNILPRGCGGFQRERISSFLETVDQYDVIMLQEVYAASVLPYFLQNRMCFQKMLVDELVLRGF 104 
146091517    1 MSASDIGCASARVLSYNFNILPRGSGGYQHERIETFLASVDAYDVVLLQEVYATSYFPYVMQKQLCYQKMLLDGLKAKGF 80  
154340187    1 MPTNDGGCASARVLSYNFNILPRGSGGYQHERIETFLASIDAYDVVLLQEVYATSYFPYVLQKQLCYQKMLLDGLKAKGL 80  
157871486    1 MSASDVGCASARVLSYNFNILPRGSGGYQHERIETFLASVDGYDVVLLQEVYATSYFPYVMQKRLCYQKMLLDGLEAKGF 80  
146095976   81 HHYVISRQPSYLTMLRYNVCSDNGLIIASRFPVWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAQGkGSQRIVFFNVHL 160 
71653816   108 THYVISKQPSYPTIFRHNVHSDNGLIIASRFPIEQCGSYTFGCNKRGSQSVRRGCLFAEVMVPLREG-GSVPILFFNVHL 186 
71650128   108 THYVISKQPSYPTIFRHNVHSDNGLIIASRFPIEQCGSYTFGCNKRGSQSVRRGCLFAEVMVPLREG-GSVPILFFNVHL 186 
71755785   105 QHYAISKQPSYTTMLRNNVFSDNGLIIASRFPIGQRGSYTFRSHERAVQSVRRGCLFAEVKVPLTSG-GEESIIFFNVHL 183 
146091517   81 HHYVISRQPSYLTMLRYNVCSDNGLIIASRFPVWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAQGkGSQRIVFFNVHL 160 
154340187   81 HYYVISRQPSYLTMLRYNVCSDNGLIIASRFPIWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAHGeGSQRIVFFNVHL 160 
157871486   81 HHYVISRQPSYLTMLRYNVCSDNGLIIASRFPVWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAHGkGSQRIVFFNVHL 160 
146095976  161 RPEDNLPSESSQMQQVHRFVEAALAQVQEQRTDgdelaalqqkGAEVPFIIAGDFNIHGIDPLN-GHPSKRFQEMLNQFQ 239 
71653816   187 RQDESTVATFSQVMETRRFIDSVISNLYGENNE----------ASKIPLVVAGDFNINGIDPHNgGKPTKIFMELMQELQ 256 
71650128   187 RQDESAVATFSQVMETRRFIDSVIGNLYAENNE----------ASKIPLVVAGDFNINGIDPHNgGKPTKIFMELMQELQ 256 
71755785   184 RQEDSDDVTSEHVKETRQFAASVIRNMCSNPED----------VAQIPFVLAGDFDVNGINLHNvGQPTKKYEDLLGELQ 253 
146091517  161 RPEDNLPSESSQMQQVHRFVEAALAQVQEQRTDgdelaalqqkGAEVPFIIAGDFNIHGIDPLN-GHPSKRFQEMLNQFQ 239 
154340187  161 RPQDNLPSESSQMQQVHRFVEAALTQVREQHNGnnapgvrqrkGAEVPFIIAGDFNIYGIDPVT-GHSSKRFQEMLNQFQ 239 
157871486  161 RPEDNLPSESSQMQQVHRFVEAALAQVREQHADgggpaalqpkGAEVPFIIAGDFNIHGIDPLN-GHPSMRFQEMLNQFQ 239 
146095976  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLATTCIQVEKPRLEKYVVSSRRPYTYLSDHFGIT 318 
71653816   257 PLGGgLSEVILDTHGYHPSTRPSKLFFPSQSKLNRDSLTPQRQDFFFVTPAVDVRMACIKKFIASSRSPYVYLSDHFGVS 336 
71650128   257 PLGGgLSEVILDTHGYHPSTRPSKLFFPSQSKLNRESLTPQRQDFFFVTPAVDVRMACIKKFIASSRSPYVYLSDHFGVS 336 
71755785   254 ALGSgVREAVFDAQHRHPPTRPTELFFPTQSKLVRNSFSPQRQDYFFVSHTVAVKNPDIHKFVSDSQQPYTYLSDHFGVS 333 
146091517  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLATTCIQVEKPRLEKYVVSSRRPYTYLSDHFGIT 318 
154340187  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLAEARIQVEKPHLEKYVVSRRRPYTYLSDHFGIT 318 
157871486  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLATKCIQVEKPRLEKYVVSSRRPYTYLSDHFGIA 318 
146095976  319 CRVTLALNPSVSFEGRSLLRLNFSSLVEAANHEHSNPSSDARLEAVLIAAFVWWLFSFSFMSLVLCAAfAWLVRWAQNYS 398 
71653816   337 ATLCVSASDQRIPHKNSTRPLLKTSMSRGIVHEHSNPLLSMKMQFIPLLLTAWAAMYFNSLTLCVLGA-VWFLLWCFVSR 415 
71650128   337 ATLCVSASDQRIPHKNSTRPLLKTSMSRGIVHEHSNPLLSMKMQFIPLLLTAWAAMYFNSLTLCVLGA-VWFLLWCFVSR 415 
71755785   334 AVLAIPQTSKQRHKRWMPLTESNAPESEETVNEHSNPIFSIIVEIIVLCTVSWAAFCFSWVALLFSLL-VGVLVWYCLSP 412 
146091517  319 CRVTLALNPSVSFEGRSLLRLNFSSLVEAANHEHSNPSSDARLEAVLIAAFVWWLFSFSFMSLVLCAAfAWLVRWAQNYS 398 
154340187  319 CRVTLPLNERDNFQARSYSRLNVSSLVEAANHEHSNPTSDARLEAVLIAVLAWWLFSFSFTSLMLCAAlVWLVRWAQHYS 398 
157871486  319 CRVTLALNPSVCFEGRSLVRLNFSSLVEAANHEHSNPSSDARLEAVLIAAFVWWLFSFSFMSLVLCAAfAWLVRWAQNYS 398 
146095976  399 ASPVLSEPPLLTMEALKEKGEMCFA---NSSLNPLAGVRTLGEMWERSVTRFRTFKCLGATSEVGESEWMTYGTVDVRAR 475 
71653816   416 IHALSNERQFATVRSAVVEGKEAVTlnqPKEYKTLQGVKSLAELWQKTVQHHSMLRCLGQNKESGESEWLTYADVDAKVR 495 
71650128   416 IHALNNERQFATVRSAVVEGKEAVTlnhPREYKTLQGVKSLAELWQKTVQHHSMLRCLGQNKESGESEWLTYADVDAKVR 495 
71755785   413 IHELRSERKFTRVGNSNAHGGEGCVsdlPREYESLKHANSVGEMWRRAVSLHSAQRCLGQKNDAGVPEWLTFVSVDARAQ 492 
146091517  399 ASPVLSEPPLLTMEALKEKGEMCFA---NSSLNPLAGVRTLGEMWERSVTRFRTFKCLGATSEVGESEWMTYGTVDVRAR 475 
154340187  399 ASPVLGEPPLLTMEALKEKGDMCFA---NTAFNPLAGVRTLGEMWERSVARFRTFKCLGATSELGEPEWITYGTVDIRAR 475 
157871486  399 ASPVLSEPPLLTMEALKEKGEMCFA---NKALNPLAGVRTLGEMWERSVTRFRTFKCLGATSELGEPEWMTYGTVDIRAR 475 
146095976  476 ELGAGLLEMGFRAGDLIGVACEPCRNIVILEVACALYGFTTVPLAGKRSTMSALLDRHKIRVAVGDRSSVAMLLTCRSTK 555 
71653816   496 ELGSGLCALGVVPGDVIGVDCQANREAVILEIACVMYGFTTLTLVGRGNAFRTLIDEHNVKVVFASRNNVASILTCRSRH 575 
71650128   496 ELGSGLCALGVVPGDVIGVDCQANREAVILEIACVMYGFTTLTLVGRGNAFRTLIDEHNVKVVFAGRNNVASILTCRSRH 575 
71755785   493 ELASGLAALGVGPGDVIGVDCDASVDSTVLELACATYGIATLALVGKGSTIRNLIDEYDIKVVFAARNAVGAILTCRSRS 572 
146091517  476 ELGAGLLEMGFRAGDLIGVACEPCRNIVILEVACALYGFTTVPLAGKRSTMSALLDRHKIRVAVGDRSSVAMLLTCRSTK 555 
154340187  476 ELGAGLLKMDFRAGDLIGVACEPSRSIVILEVACALYGFTTVPLAGKRSTMRTLLDRHKIRVAVGDRNSVVALLTCRSTK 555 
157871486  476 ELGAGLLEMGFRAGDLIGVACEPCRNIVILEVACALYGFTTVPLAGKRSTMSALLDRHRIRVAVADRSSVAMLLTCRSTK 555 
146095976  556 LEAVMYTSAFADEDDHATAKDLNIRLIPFEFVEQKGRLCPVaPAKEHVTTDSVFTYTLDNTNSlASDDGSALLPVRHSSV 635 
71653816   576 LETVVNVHSFYDAEDDAVARDFGITLLLYDGVCYNGRLRLV-PPPLHVASETVFSLVVDTTTT-NMGSSLSVVRMTHADV 653 
71650128   576 LETVVNVHSFYDAEDDAVARDFGITLLLYDGICYNGRLRLV-PPPLHVASETVFSLVVDTTTT-NLGSSLSVVRMTHADV 653 
71755785   573 LETLVCMHSSHDSTDCMVARDVCITLISYNEVFSKGRSQPV-LLRPVCDDTTLYTMVVDPSTS---NGNLKVVRVTHADA 648 
146091517  556 LEAVMYTSAFADEDDHATAKDLNIRLIPFEFVEQKGRLCPVaPAKEHVTTDSVFTYTLDNTNSlASDDGSALLPVRHSSV 635 
154340187  556 LEAVLYTSAFVDESDHAAAKDLNIRLIPFEFVEQKGRLSPVaPLKEHVTTDSVFTYTMDNTDSvACGDESALLPVRHSTI 635 
157871486  556 LEVVMYTSAFVDEDDHATAKDVNIRLIPFEFVEQKGRLCPVaPAKEHVTTDSVFTYTLDNTNSlASDDGSALLPVRHSSV 635 
146095976  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFQPTLLVTAPTLFSTSRLQ 715 
71653816   654 LRDICTLVATSVLPTSRKKHLVVHFTPFSMVFNRIFVLGLFAHGSSVATSEGAS-RRAFTVFRPTIMLAVPSLFATSETQ 732 
71650128   654 LRDICTLVATSVLPTSRKKHLVVHFTPFSMVFNRIFVLGLFAHGSSVATSEGAS-RRAFTVFRPTIMLAVPSLFATSETQ 732 
71755785   649 LRAIRTLVGTAVLPNTQHKHLLVHYTPFAMLFNRLFVLGLFAHGSAVATTPVAAcARAFATIQPTIVVATPSLFSTSAVQ 728 
146091517  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFQPTLLVTAPTLFSTSRLQ 715 
154340187  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFHPTLLVTSPALFSTSRLQ 715 
157871486  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFQPTLLVTAPTLFSTSRLQ 715 
146095976  716 LSRAQHRHSAVYNWFFNRTFQLRSRLIHIKRQDSSLLRFMFFRAFQEQLGGRVRKIILSVSQESTAFSLLEHVSVCYVPL 795 
71653816   733 LKRKNERYGCVYSWLFEKAFQLRSVLINVHRRDSPVLRLIFFRSTQRLLGGCVEKVVLCVSEESTSYRLEEHIAVCYAPC 812 
71650128   733 LKRKNERYGCVYSWLFEKAFQLRSVLINVHRRDSPVLRLIFFRSTQRLLGGCVEKVVLCVSEESTSYRLEEHIAVCYAPC 812 
71755785   729 LRRRNERYWPIFSWIFEQIYHLRLFLINTHNRDSLILRTIFFRGTQHLFGGNVEKIVVCSSEESLSDTLAEHIVVCYTPC 808 
146091517  716 LSRAQHRHSAVYNWFFNRTFQLRSRLIHIKRQDSSLLRFMFFRAFQEQLGGRVRKIILSVSQESTAFSLLEHVSVCYVPL 795 
154340187  716 LSRAQHRHSSVYNWFFNRAFQLRSRLIHLKRQDSSLLRFIFFRAFQEQLGGCVRKIILSVSQESTTFSLLEHISVCYVPL 795 
157871486  716 LSRAQHRHSAVYNWLFNRAFQLRSRLIHIKRQDSSLLRFIFFRAFQEQLGGRVRKIILSVSQESTAFSLLEHVSVCYVPL 795 
146095976  796 VCEVSYLNCFGVCAIDGTTAPSLQVDLEPINDLSDGVGIGQLVIAKKGePRRRLEIAAQWKRDGTVKFLGEPLGILWPVA 875 
71653816   813 LREVFFIPSEGVFCVDGIPAPGVRVELEPFDEPSTKNTFGQLTLLRRS-AKHTLPIAAKWNDQRTLRLMGPPGGILLPLK 891 
71650128   813 LREVFFIPSEGVFCVDGIPAPGVRVELEPFDEPSTKNTFGQLTLVRHS-AKHTLPIAAKWNDQRTLRLMGPPGGILLPLK 891 
71755785   809 LREVFFLPSEGVFCVDGVPAPNIHVHLEPFDEPSKEAKIGSLVLSCEGrKERTLPIAAMWTGTRTLRLIGPPDGVLLPVR 888 
146091517  796 VCEVSYLNCFGVCAIDGTTAPSLQVDLEPINDLSDGVGIGQLVIAKKGePRRRLEIAAQWKRDGTVKFLGEPLGILWPVA 875 
154340187  796 VCEVSYLNCVGVCTIDGTPAPSMQADLEPISDLSNSAGIGQLVITKKGePRRRLEIAAQWKRDGTAVFLGAPLGILWPVA 875 
157871486  796 VCEVSYLNCLGVCAIDGMTVPSLQVDLEPISDLSDGVGIGQLVIAKKGePRRRLEIAAQWKRDGTAKFLGEPLGILWPVA 875 
146095976  876 YQYAIAAELERIFSVSRYINAIFVYCDPLKPIIAVVYPNRDTIEFEWRQSHC----------CDGPARQLGWTDLVAYAT 945 
71653816   892 GEYVVAAELERIFAQSRYVNDIFLYARPSRPIIAIVSPNRDTVEFEWQQQHSmgvnnngeaeGGAGSASLSWTELSRYAS 971 
71650128   892 GEYVVAAELERIFAQSRYVNDIFLYARPSRPIIAIVSPNRDTVEFEWQQQHSmgvnnngeaeGGAGSASLSWTELSRYAS 971 
71755785   889 SEYVLAASLERVFSQSRYVNDVFLYAEPSRPIIAIISPNRDTVDFEWRQSREge-------vAGEDNLLSNWAKFASFAS 961 
146091517  876 YQYAIAAELERIFSVSRYINAIFVYCDPLKPIIAVVYPNRDTIEFEWRQSHC----------CDGPARQLGWTDLVAYAT 945 
154340187  876 YQYAIAAELERIFSVSRYVNAIFVYCDSLKPIIAVVYPNRDTIEFEWHLSHG----------GDGPARQLGWKELVEYAM 945 
157871486  876 YQYTIAAELGRIFSVSRYINAIFVYCDPLKPIIAVVHPNRDTIEFEWRQSHC----------CDDPARQLGWTELVAYAT 945 
146095976  946 SIITADLACIAREEQLHPSQVPEFVHLHPHAFSDHSTFLTPFGKIRRDAVHKYFSSVFERLYSGVATSPLAALTADLQED 1025
71653816   972 GLLLADFSCIAKLNGLQASNVPEYVHPHPHSFKDHGNFFTPYGKLRRDCVTRYFTSVIERFYSDTESTFSPTPCYTSSGN 1051
71650128   972 GLLLADFSCIAKLNGLQASNVPEYVHPHPHSFKDHGNFFTPYGKLRRDCVTRYFTSVIERFYSDTESTFSPTPCYTSSGN 1051
71755785   962 DLLTADFQVIAKRNALHESNVPSYVHIHPHAFKKHDSFLTPYGGIRRNSLKSYFKVVIEGFYNDATPTALPTPGQIIESD 1041
146091517  946 SIITADLACIAREEQLHPSQVPEFVHLHPHAFSDHSTFLTPFGKIRRDAVHKYFSSVFERLYSGVATSPLAALTADLQED 1025
154340187  946 SIISADLASIAGEAHLHPSQIPEFVHLYPHAFSDHSTFLTPFGKIRRDAVHSYFSSVFERLYNGSETLPLAALSVDWQED 1025
157871486  946 SIITADLASIAREEKLHPSQVPEFVHLHPHAFSDHSTFLTPFGKIRRDAVHKYFSSVFERLYSGVATSPLAALSADLPED 1025
146095976 1026 VSDVESSGTkLGSICDFDLRVPVTIDIGGTFAKIAFIMPPTGGAFPTFpsIIHEASSLSEKLGLRTFYFFADEEAAESEL 1105
71653816  1052 SSDIDCAGT-LSHDQQFSLQVPAAIDIGGSFAKFLYVQPPGFFEIPDY--MVHESSSLSERLGLRTFHFFADAPVLEEQP 1128
71650128  1052 SSDIDCAGT-LSHDRQFSLQVPAAIDIGGSFAKFLYVQPPGFFEIPDY--MVHESSSLSERLGLRTFHFFADAPVLEEQP 1128
71755785  1042 ----EEGQAyERDQKPFSLNTPISIDVGGTFAKLVYVQPPGDFKVPHY--VVKEAAVLAEGFNVRMLDLLDNAEGMKRLL 1115
146091517 1026 VSDVESSGTkLGSICDFDLRVPVTIDIGGTFAKIAFIMPPTGGAFPTFpsIIHEASSLSEKLGLRTFYFFADEEAAESEL 1105
154340187 1026 VSDAESSVTrVSSMCSFDLQVPVTIDIGGTFAKIAFVMPPMTDTLPTFpsIIHEASSLSEKLGVRTFHFFAGEEAANNEL 1105
157871486 1026 VSDVESSGTkLGSVCDFDLRVPVTIDIGGTFAKIAFIMPPTGGAFPTFpsIIHEASSLSEKLGLRTFQFFADEEAAESEL 1105
146095976 1106 RTRSHSRVGTLRFLKIPSQQVPRFADYLAGSHAINNFKPQYTTKVRATGGGAFKYASVARNVLGIEFDVVKEMDAVVKGL 1185
71653816  1129 QGLRSSSVGTVRFAKVPSKRIPDFVAYLEKNKPHNFYAEAFRKSIRATGGGAFKYASIAKKRLHVSFEVMREMDSVVHGL 1208
71650128  1129 QGLRSSNVGTVRFAKVPSKRIPDFVAYLEKNKPHNFYAEKFRKSIRATGGGAFKYASIAKKRLHVSFEVMREMDSVVQGL 1208
71755785  1116 NDDPFSTVGTLQFAKMSSKCIPDFMSYIVESQMLSYYTKEYRNTLRVTGGGAFKYAALAKK-MDLNFSVMREMSAVVHGL 1194
146091517 1106 RTRSHSRVGTLRFLKIPSQQVPRFADYLAGSHAINNFKPQYTTKVRATGGGAFKYASVARNVLGIEFDVVKEMDAVVKGL 1185
154340187 1106 RTRPHSRVGTLRFLKIPSQQIPRFADYLASIHAIKYFKPQYTTQVRATGGGAFKYASTARSVLGINFSVVREMDAVVKGL 1185
157871486 1106 RTRSHSLVGTLRFLKIPSQQVPRFTDYLAGSHAINNFKPQYTTKVRATGGGAFKYASVARNVLGIEFDVVKEMDAVVKGL 1185
146095976 1186 NLVLRVAPESVFTVDPSTGVHHPHQLVS-NGDGFSPFPYLLINIGSGISFIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
71653816  1209 TLLIRSAPWSIFTVDPTTGIHYPHKLRSpPGDTLSPFPCLLVNIGSGISIIKCLGPDGSHVRVGGSPIGGATFWGLVRTM 1288
71650128  1209 TLLIRSAPWSIFTVDPTTGIHYPHKLQSpPGDTLSPFPCLLVNIGSGISIIKCLGPDGSHVRVGGSPIGGATFWGLVRTM 1288
71755785  1195 GVVIGRAPETIFTVDPATGERHPHRLKSpPGEPFSPYPCLLVNIGSGISIIKCLGPDGSHVRIGGSPMGGATFWGLVRTM 1274
146091517 1186 NLVLRVAPESVFTVDPSTGVHHPHQLVS-NGDGFSPFPYLLINIGSGISFIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
154340187 1186 NLVLRIAPESVFTVDSITGVHQPHQLVS-SGDGFSPFPYLLINIGSGISFIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
157871486 1186 NLVLRVAPESVFTVDPSTGVHHPHQLVS-NGDGFSPFPYLLVNIGSGISLIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
146095976 1265 TNLTSWEEVMEIMRLDGPGDNKNVDLLVGDIYGYNAKDLPAMLSSETVASTFGKLGTERFYDMRRSVCTAHFADDDAaGE 1344
71653816  1289 TDVTSWEEVLEIMRLDGPGDNKNVDLLVGDIYGYNAHDLPAMLSVDTVASSFGKLGADRFYEAMAGGSLRRNSGDDN-GN 1367
71650128  1289 TDVTSWEEVLEIMRLDGPGDNKNVDLLVGDIYGYNAHDLPAMLSVDTVASSFGKLGADRFYEAMAGGSLRRSSGDDN-GD 1367
71755785  1275 TAVTSWEEITETMRLDGPGDNRNVDLLVGDIYGYNAKDLPPMLSVDTVASTFGKLGTERFYESQGNVDRLYASSSEDlSG 1354
146091517 1265 TNLTSWEEVMEIMRLDGPGDNKNVDLLVGDIYGYNAKDLPAMLSSETVASTFGKLGTERFYDMRRSVCTAHFADDDAaGE 1344
154340187 1265 TNLTSWEEVIEIMRLDGPGDNKNIDLLVGDIYGYNANDLPAMLFSETVASTFGKLGTERFYDLSRGDSTTHFADDDAtGE 1344
157871486 1265 TNLTSWEEVMEIMRLDGPGDNKNVDLLVGDIYGYNAKDLPAMLSSETVASTFGKLGTERFYDMKRNICTAHFADDDAaGE 1344
146095976 1345 ILSPkaLKTPSVISEL-PVRNGTKAASAIDIVRSLLNMISSNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISTTM 1423
71653816  1368 VISP--LPSPTVSSPT-SLWKGKTKPSAIDIVRSLLNMISANITQLAYLHSRVQNVENIFFAGGFVRDNPIIWSHISSTL 1444
71650128  1368 VISP--LPSPTVSSPT-SLWKGKTKPSAIDIVRSLLNMISANITQLAYLHSRVQNVENIFFAGGFVRDNPIIWSHISSTL 1444
71755785  1355 AVSSspDSNPTLHDAVaPTLASHGKTSEIDIVRSLLNMISSNVTQLAYLHSRVQDVHNIFFAGGFVRNNPIVWSHISSFM 1434
146091517 1345 ILSPkaLKTPSVISEL-PVRNGTKAASAIDIVRSLLNMISSNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISTTM 1423
154340187 1345 ILSPkaSKASSMVSKR-PARNGTKAASAIDIVRSLLNMIASNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISSTM 1423
157871486 1345 ILSPkgSKSPSVISEL-PVRNGTKAASAIDIVRSLLNMISSNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISTTM 1423
146095976 1424 KYWSSGGCHAHFLEHDGYLGALGCAILDPQGDAAKE 1459
71653816  1445 QYWSKGESHAHFLKHDGYLGVLGSATMPTDSETASK 1480
71650128  1445 QYWSKGESHAHFLKHDGYLGVLGSATMPTDSETASK 1480
71755785  1435 AYWSKGECHAHFLGHDSHLGALGAATNTEEHVS--- 1467
146091517 1424 KYWSSGGCHAHFLEHDGYLGALGCAILDPQGDAAKE 1459
154340187 1424 KYWSSGECHAHFLEHDGYLGALGCAILNSHRDATNE 1459
157871486 1424 KYWSSGECHAHFLEHDGYLGALGCAILDPHGDAANE 1459
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap