Conserved Protein Domain Family
PTZ00284

?
PTZ00284: PTZ00284 
protein kinase; Provisional
Statistics
?
PSSM-Id: 140307
View PSSM: PTZ00284
Aligned: 11 rows
Threshold Bit Score: 893.551
Threshold Setting Gi: 74025476
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71416896    1 MDSLAGNLGAARTGIQQYTVGQ-----------------ANVASGNGGKALNSARSTMTTSQSTNSARRSGSKRDRETAT 63 
71659275    1 MDTLAGNLGAARTGIQQYTVGQ-----------------ANVASGNGGKALNSARSTMTTSQSTNSARRSGSKRDRETAT 63 
71659277    4 FATRSAVLSSAQCLLPATNMNDrsyynfaargkqkpkppVNTLSSSSPKKPTQENTLQSREEEQFFSRRSGSKRDRDTAI 83 
71416901    4 FATRSAVLSSAQCLLPATNMNDrsyynfaasgkqkpkppVNTLSSSAPKKPTQENTLQSREEEQFFSRRSGSKRDRETAT 83 
74025474    1 MDSISSGLTH-RAGLQQYPSGL-----------------VNVHVNNNPKINNGACSNMTPRESTNSARRSGSKRDRETAD 62 
74025476   11 SSTIAKGMSGDTAGFYGSSTTAmvp-----------ppvVIASKTNHPKNQQYQSTFQADERGITHPRRSASKRDRDNGI 79 
154332792   4 VHTRLAPVTNIINNAYTTTAGApilrkp------emtptASTTYASSREAAVSTSHGASTNKVTATASVMVTSRG-EEAA 76 
146078244   5 SAAADAGGAAARSGLHVYSSAQa----------------NAAGSGTAALPNKALDHMKHMSRSKSDARRSGSKRTFDEAT 68 
146078248   4 LQSRLAPITNINNNAYTTTAGApilrkp------emtsaASAVYISRKEAAVSSSHGAPTNKMMATAAVTGSSRC-EEAT 76 
157865012   1 --------------------------------------------------------MKHMSRSKSDARRSGSKRTFDEAT 24 
157865014   1 ---------------------------------------------------------------MATAAVTGSGRG-EEAT 16 
71416896   64 STDITRTKSQYGEVTKKQATATTTTTstnttttttttttatagganriVEVLPLPKKKKVTYALPNQSREEGHFYVVLGE 143
71659275   64 STDITRTKSQYGEVTKKQATATTTTNntttttta------tagganriVEVLPLPKKKKVTYALPNQSREEGHFYVVLGE 137
71659277   84 STDITRTKSQNKAAARKSTTTTPTTNaa------------------aaVGGTAKQTKVKVTYVLPNQSREEGHFYVVLGE 145
71416901   84 STDITRTKSQNKAAARKSTTTTPTTNaa------------------aaVGETAKQTKVKVTYVLPNQSREEGHFYVVLGE 145
74025474   63 TADDGRNKNNQSITGTTATTTSTAKH----------------------SEMQPPPKKKKVTYALPNQSREEGHFYVVLGE 120
74025476   80 EQPSAIDQSATAANNSADSAVTPKSAh--------------------gVTSYASNKKKKVTYALPNQSREEGHFYVVLGE 139
154332792  77 GRRSGSKRDHEASITTDQNPQVVEVM-------------------------APPPKKKKVTYALPHQNMEEGHFYVVLGE 131
146078244  69 ATDNVQLRRHDGTAVPNTAPNQVVEV------------------------VAPPPKKKKVTYALPHQNMEEGHFYVVLGE 124
146078248  77 GRRSGSKRDHETSVTTDQNPQDAAKS------------------------LPPPPKKKKVTYALPHQNMEEGHFYVVLGE 132
157865012  25 VTDNVQQRRHDGTAVPNTAPNQVVEV------------------------VAPPPKKKKVTYALPHQNMEEGHFYVVLGE 80 
157865014  17 GRRSGSKRDHETSVTTDQNPQDAAKA--------------------------LPPLKKKVTYTLPHQNMEEGHFYVVLGE 70 
71416896  144 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 223
71659275  138 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 217
71659277  146 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 225
71416901  146 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 225
74025474  121 DIDASTGRFKILSLLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMERVRLSDVEDRFPLMKIQRYFQN 200
74025476  140 DIDASTGRFKILSLLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMERVRLSDVEDRFPLMKIQRYFQN 219
154332792 132 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 211
146078244 125 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 204
146078248 133 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 212
157865012  81 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 160
157865014  71 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 150
71416896  224 ETGHMCIVMPKYGPCLLDWIMKHGALSHRHLAQIIFQAGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 303
71659275  218 ETGHMCIVMPKYGPCLLDWIMKHGPLSHRHLAQIIFQVGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 297
71659277  226 ETGHMCIVMPKYGPCLLDWIMKHGPLSHRHLAQIIFQAGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 305
71416901  226 ETGHMCIVMPKYGPCLLDWIMKHGALSHRHLAQIIFQAGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 305
74025474  201 ETGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIIFQVGAALDYFHTELHLMHTDLKPENILMESGDTSVDPMTHRALPP 280
74025476  220 ETGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIIFQVGAALDYFHTELHLMHTDLKPENILMESGDTSVDPMTHRALPP 299
154332792 212 DSGHMCIVMPKYGPCLLDWIMKHGPFNHRYLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDSAVDPVTNRQLPP 291
146078244 205 DSGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 284
146078248 213 DSGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 292
157865012 161 DSGHMCIVMPKYGPCLLDWIMKHGPFSHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 240
157865014 151 DSGHMCIVMPKYGPCLLDWIMKHGPFSHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 230
71416896  304 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 383
71659275  298 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 377
71659277  306 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELCTGKLLYDTHDNLEHLHLMEKTLG 385
71416901  306 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 385
74025474  281 EPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVVLSLGWMYSTDLWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 360
74025476  300 EPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVVLSLGWMYSTDLWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 379
154332792 292 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLC 371
146078244 285 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 364
146078248 293 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 372
157865012 241 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNAEHLHLMEKTLG 320
157865014 231 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNAEHLHLMEKTLG 310
71416896  384 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 463
71659275  378 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 457
71659277  386 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 465
71416901  386 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 465
74025474  361 RLPADWSVRCGTQEARDLFTAAGTLQPCKDPKHIARIARARPVREVITEPLLCDLILNLLHYDRQRRLNARQMMSHAYVH 440
74025476  380 RLPADWSVRCGTQEARDLFTAAGTLQPCKDPKHIARIARARPVREVITEPLLCDLILNLLHYDRQRRLNARQMMSHAYVH 459
154332792 372 RLPSEWATRCGTEEARLLYSSTGHLRPCTDPKHLARVARARPVRDVIRDDLLCDLIHGLLHYDRQKRLNARQMTTHPYVL 451
146078244 365 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 444
146078248 373 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 452
157865012 321 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 400
157865014 311 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 390
71416896  464 KYYPECRQHPNYPDNRPSLRPTPLM 488
71659275  458 KYYPECRQHPNYPDNRPTLRPTPLM 482
71659277  466 KYYPECRQHPNYPDNRPSLRPTPLM 490
71416901  466 KYYPECRQHPNYPDNRPSLRPTPLM 490
74025474  441 KYFPECRQHPNHVDNRSKLPPTPVM 465
74025476  460 KYFPECRQHPNHVDNRSKLPPTPVM 484
154332792 452 KYYPEARQAPSYPDNRSMLRPPPIM 476
146078244 445 KYYPEARQAPSYPDNRAMLRPPPIM 469
146078248 453 KYYPEARQAPSYPDNRAMLRPPPIM 477
157865012 401 KYYPEARQAPSHPDNRSMLRPPPIM 425
157865014 391 KYYPEARQAPSHPDNRSMLRPPPIM 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap