Conserved Protein Domain Family
PTZ00276

?
PTZ00276: PTZ00276 
biotin/lipoate protein ligase; Provisional
Statistics
?
PSSM-Id: 140302
View PSSM: PTZ00276
Aligned: 6 rows
Threshold Bit Score: 458.176
Threshold Setting Gi: 74025008
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146094843   1 MPAHFPPKIHFLDEVTSTMDVARTMRATA--GGKAFAVVAAEQTAGRGTGGRTWTSPKGNLYMTFGVPQLGQPPclkeEL 78 
71402075    1 MPMDVPPNIHHVGEVTSTMDAARQMLTAA--NGVPFAVLAESQVRGRGTGERVWISPKGNMYFTLCIPEKSVTP----EI 74 
71664409    1 MPMDVPPNIHHVGEVTSTMDAARQMLTAA--NGAPFAVLAESQVRGRGTGERVWISPKGNMYFTLCIPEKSVTP----EI 74 
74025008    1 MSAFLTPKIHLVGDVSSTMDVVREMLAASpsDTEPFAVLAESQSSGRGTTGRQWSSPRGNMYFSLCLPTTLVAA----EF 76 
154342354   1 MPANFPPNIQFLEEVGSTMDVARTMKMTA--GGQPFALVAAVQTAGRGTCGRTWTSPKGNLYMTLGIPQQGQPPcfkeEL 78 
157873157   1 MPAHCPPNIHFLEEVTSTMDVARTMRATA--GGKAFAVVAAEQTAGRGTGGRTWTSPKGNLYMTVGVPQLGQPPclkeEL 78 
146094843  79 VPVLPLICGLACRLAVLEVLHldrvsakasvaadaAKAVSTKWPNDIIYNHKKIGGTLIENDGDYFIIGIGMNIAVAPQM 158
71402075   75 TPVLPLLTGLVCRAAIMSVIK--------------GAVLHLKWPNDIIYAGKKIGGSLVESEGESLIIGIGMNVELAPPV 140
71664409   75 TPVLPLLTGLVCRAAIMSVIK--------------GADVHVKWPNDIIYAGKKIGGSLVESEGESLIIGIGMNVELAPPV 140
74025008   77 LPVLPLATGLACRAAIMELVE--------------GAVVHVKWPNDIIYDGKKIGGSIAECEGEHLIVGIGINIEVAPPV 142
154342354  79 VHVLPLICGLACRRAVLEVLHldeasakaslaaeaSKAVSTKWPNDIIYKHKKIGGSLIEADGDYFIIGIGVNVAVTPQV 158
157873157  79 VPVLPLICGLACRRAVLEVLHldgalakasvaadaAKAVATKWPNDIIYNHKKIGGTLIESDGDYLIIGIGMNIAVAPQM 158
146094843 159 TDAGREATMINAIAEDFGVKSCTPRDLANAIWCHFFDICTSPEWTRESVIESFDKVMDKSLKLHKRLPGGRDPEELTAVS 238
71402075  141 TDSGRASTTVNEIAAALGQPKVTPAQLAELVWKHFFQMISDTALTRKILVSRFDAAMDKSLSLHRRTPTGRDPEELRALR 220
71664409  141 TDSGRASTTVNEVAATLGQPKVTPAQLAELVWKHFFQMISDTALTRKILVTRFDAAMDKSLSLHRRTPTGRDPEELRALR 220
74025008  143 PDGGRPSYAVNSIASVLGKGAVTPQLLAEAVWRNFFSAVADQGFKRPELIKQFEAAMDKSLVLHKRTPTGRDPMPLHALK 222
154342354 159 TDAGREATMVNAIAEEFGVKSCTPQDLAKAIWHHFFDICTSPEQTRESVIESFDKVMDKSLKLHKRLPGGRDPEELTAVS 238
157873157 159 TDAGREATMINTIAEDFGVKSCPPRDLANAIWCHLFDICSSPEWTRELVIESFDKVMDKSLKLHKRLPGGRDPEELTAVS 238
146094843 239 LNSWGHLKVRHTDGTLEDLSAEYLF 263
71402075  221 LNEWGHLIVSRPDGTEETLMAEYLF 245
71664409  221 LNEWGHLIVSRPDGTEDTLMAEYLF 245
74025008  223 LNEWGHLVVGRPDGSEEVLVAEYLF 247
154342354 239 LNSWGHLRVRHADGTMEDLAAEYLF 263
157873157 239 LNSWGHLKVRHADGTVEDLSAEYLF 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap