Conserved Protein Domain Family
PTZ00274

?
PTZ00274: PTZ00274 
cytochrome b5 reductase; Provisional
Statistics
?
PSSM-Id: 140300
View PSSM: PTZ00274
Aligned: 4 rows
Threshold Bit Score: 641.199
Threshold Setting Gi: 146094721
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
73544265    1 MRFAVSCVAGAVGAWVWRR-PSGQDAECYQGIQNAITFRNPQRQGRVFSQRYEPYQLGEIIPITADVALFRFLLHnSEDE 79 
71652882    1 MRVVVSFAAGLLAALLHRPvDDAFPAECYRSIENALHFRNKKRDGEVFSQRYEPYQLGEVIPITHDTALFRFLLH-ADEE 79 
71754615    1 MRFVPPFLAGAALATYYRPlDKSKSAYCYASIENALHFQPKPKPGKVFSQRYQPYTLGDVVPITHDTALFRFLID-GNEE 79 
146094721   1 MRFAVSCVAGVVGAWVWRR-SSGQDAECYRGIQNALTFHNPDRKGRVFSQRYEPYQLGEIIPITADVALFRFLLHhSEDE 79 
73544265   80 FNLRPCSTLQACYKYGVQPKDQCQRFYTPVTANHTAGYFDLIVKRKKDGLMTNHLFGMHVGDTLLFRSVAFKIQYRPNRW 159
71652882   80 FNLKPCSTLQACYKYGVQPMEQCHRFYTPVTANRTKGYFDIIVKRKNSGLMTTHLFGMHVGDKLLFRSVTFKVQYKPNKW 159
71754615   80 FNLKPCSTLQACYKYGVQPMDQCQRFYTPVTANHTKGYFDIIVKRKQGGLMTEHLFGMHIGDKLLFRSVTFKLQYRPNRW 159
146094721  80 FNLRPCSTLQACYKYGVQPKDQCQRFYTPVTANHTAGYFDLIVKRKKDGLMTNHLFGMHVGDTLLFRSVAFKIQYRPNRW 159
73544265  160 KHVGMIGGGTGFTPFLQIVRHALTEPVDSKEVDRTKLSFLFCNRTERHILLGGVFDDLARRFPDRFRMFYTIDLAVDKDK 239
71652882  160 NHVGMIAGGTGFTPMLQIIRHSLMEKWNDGSVDNTKLSFLFCNRTEKHILLKGLFDDLAERYSNRFKVYYTVDQPVEPEN 239
71754615  160 KHVGMIAGGTGFTPMLQIIRHSLQEEWDNGMVDRTKLSFLFCNRTERHILLKGLFDDLAQKYSNRFKVYYTIDQAVEPDV 239
146094721 160 KHVGMIGGGTGFTPFLQIIRHALTEPVDSKEADRTKLSFLFCNRTERHILLGGVFDDLARRYPHRFRMFYTIDLAVDKGK 239
73544265  240 WleqeNHFLGYVTTDMIRRSMPAPEEKNKIIMLCGPDPLLSHVAGTPMSTMSSMSGSLSIQPMATDINNLVSLGGLLKEL 319
71652882  240 W----KHFVGYVSKEMVQQTMPAPDEKKKIIMLCGPDQLLNHVAGTPMGTMSAMSSGMNIQPLAPDLNNLVSLGGILGEL 315
71754615  240 W----PHYTGLVTKEMVHETMPAPNEEKKIILLCGPDQLLNHVAGTPMGTMNTMSSGMNIQPMAPDLNNLVNLGGILGEL 315
146094721 240 WleqeNHFLGYVTTDMIRRSMPAPEEKNKIIMLCGPDPLLSHVAGTPMSTMSSMSGSLNIQPMATDINNLVSLGGLLKEL 319
73544265  320 GYDNTDVYRF 329
71652882  316 GYKNDDVYRF 325
71754615  316 GYSNDEVYRF 325
146094721 320 GYDNTDVYRF 329
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap