Conserved Protein Domain Family
PTZ00273

?
PTZ00273: PTZ00273 
oxidase reductase; Provisional
Statistics
?
PSSM-Id: 140299
View PSSM: PTZ00273
Aligned: 13 rows
Threshold Bit Score: 593.273
Threshold Setting Gi: 154340892
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72392152    1 MNHTSIPVIDVSPLFREGEHrVMDVAQQIDWACRTWGFFHVVGHPISPERIGKLMEMAKTFFSLPLEEKLKINIQKS-KH 79 
71403139    1 MTAYPFPIIDVSPLYQNTGA-VMEVAKKIDEACRTWGFFYVVGHPIPRERFQELSRMARKFFSLPLEEKLQIDIKKS-RH 78 
71746166    9 TPRASLPVIDVSPLFGGAEQeIMKVAKQLDHACRTSGFLYVVGHPIKQEQIDRVLQISKTFFSLPMEEKMKIDVKKGfLK 88 
71663652    1 MTAYPFPIIDVSPLYQNTGA-VMEVAKKIDEACRTWGFFYVVGHPIPRERFQELSRMARKFFSLPLEEKLQIDIKKS-RH 78 
84043914    1 MTRASLPVIDVSPLFGGESAeKERVSKQIDNACRTWGFFYIVGHPIQQEQIERVLDVAKNYFSLPMEEKLKLDIRKS-KL 79 
84043922    1 MTRASLPVIDVSPLFGGESAeKERVSKQIDNACRTWGFFYIVGHPIQQEQIDKVLKLADTFFSLPMEEKLKLDVRKG-RL 79 
84043918    1 MTRASLPVIDVSPLFGGESAeKERVSKQIDNACRTWGFFYIVGHPIQQEQIERVLDVAKNYFSLPMEEKLQLDIRKS-KL 79 
84043930    1 MTRASLPVIDVSPLFGGESAeKERVSKQIDNACRTWGFFYIVGHPIQQEQIDKVLKLADTFFSLPMEEKLKLDVRKG-RL 79 
84043926    1 MTRASLPVIDVSPLFGGESAeKERVSKQIDNACRTWGFFYIVGHPIQQEQIDKVLKLADTFFSLPMEEKLKLDVRKG-RL 79 
73536520    1 ---MSLPVIDIAPLYSDNKAdLLRVAHAIDEACRTWGFFYITGHHIPKERIEQLTTMASKFFALPQEEKLRINIEKT-SN 76 
72388818    1 MAHGSIPVIDVGPLFCDGEKgMMDVAKQIDHACRTWGVFLVVGHPIPRERTEKLMEMAKAFFSLPLEEKLKVDIRKS-KH 79 
146092871   1 ---MPLPVIDIAPLYNDNKAdLLRVAHAIDEACRTWGFFYITGHQIPKDRSEQLTKMANKFFALPQEEKLRINIEKT-SN 76 
154340892   1 ---MFLPVIDIAPLYHDNKAdLLRVAHAIDEACRTCGFFYITGHNLPKGRMEKVTEMAEKFFALPHQEKLRINLEKS-PN 76 
72392152   80 HRGYGCLNAENVDPTKPFDCKETFDMGCHLPEDHPDVAAGKPLRGPNNHPTQVGGWMELMETHYRDMRDFALVILRALAL 159
71403139   79 HRGYGEVNAEQLDPSAPSDHKETFDMGCHLPEDHPDVVAGKPLRGPNRHPTQLEGWRELMETHYREMQQFALVLLRALAV 158
71746166   89 YRGYVPFGAEEPEHAKTYSY-EAFNMGYHLPLHHPEVMARAPLRGPNVHPTQVPEWVDIMETYFRDMWAFMLVLLRAMAR 167
71663652   79 HRGYGEVNAEQLDPSAPNDHKETFDMGCHLPEDHPDVVAGKPLRGPNRHPTQLEGWRELMETHYREMQHFALVLLRALAV 158
84043914   80 YRGYIAFGAEDPDDAKVYGY-EGFNMGHHLPKHHPEVMAGVPLRGPNIHPTQVKGWAEEMENQYDDMWALSLVILRAMAL 158
84043922   80 YRGYTAPGVEEADVGKVYTY-ETFTTGYHLPKHHPDVMAGKPLRGPNIHPTQVRGWMEGMEGHYRDMWALALVLLRAMAQ 158
84043918   80 YRGYIAFGAEDPDDAKVYGY-EGFNMGHHLPKHHPEVMAGVPLRGPNIHPTQVKGWAEEMENQYDDMWALSLVILRAMAL 158
84043930   80 YRGYTAPGVEEADVGKVYTY-ETFTTGYHLPKHHPDVMAGKPLRGPNIHPTQVRGWMEGMEGHYRDMWALALVLLRAMAQ 158
84043926   80 YRGYTAPGVEEADVGKVYTY-ETFTTGYHLPKHHPDVMAGKPLRGPNIHPTQVRGWMEGMEGHYRDMWALALVLLRAMAQ 158
73536520   77 HRGYGMCAAEQLDPSKPGDWKETFDMGFHLPLDHPSVVAGKPLRGPNNHPMWIEGWTELMEQHYSDMQGLALLLLRALAL 156
72388818   80 HRGYGCLDAENVDPTKPFDCKETFNMGCHLPEDHPDVAAGKPLRGPNNHPTQVKGWVELMNRHYREMQEFALVILRALAL 159
146092871  77 HRGYGTCAAEQLDPSKPGDWKETFDMGFHLPLDHPSVVAGKPLRGPNNHPTWIEGWTELMEQHYSDMQRLALLLLRALAL 156
154340892  77 HRGYGTYAAEQLDPSKPGDWKETFDMGFHLPPDHPSVVAGKPLRGPNNHPTWIEGWTDLMEQHYSDMQRLSLLLLRALAL 156
72392152  160 AIGLRKDFFDNKFDEPLSVFRMVHYPAQKEGSRHPLVCGEHTDYGIITLLYQDSVGGLQLRNLSDEWVDVEPIEGSFVVN 239
71403139  159 AIGIEEDFFVPRFVEPLSVFRMIHYPALPKTKEGRLVCGEHTDYGIITLLFQDTNGGLQVRDLSGEWIDAPPLEGSFVVN 238
71746166  168 GIGIREDFFDDKFSVPQCELTVKHYPEPKTHANGNTLRMEHSDYGIITILYQDSTGGLQVRNPDDKLVDVPPIEGSFVVN 247
71663652  159 AIGIEEDFFVPRFVEPLSVFRMIHYPALPKTKEGRLVCGEHTDYGIITLLFQDTNGGLQVRDLSGEWIDAPPLEGSFVVN 238
84043914  159 GLGLREDFFDSKFMDPMCELNIKHYPSPTTTGKKSHLLIEHADFCAITLLYQDGVGGLQIRGLSGELMDVPPVEGSFVVN 238
84043922  159 AIGLQEDFFDSKFMDPLCELNIKHYVPLSQTKEETTLLIEHSDFGVMTLLYQDASGGLQVRDSSGELMDVPPIEGSFVVN 238
84043918  159 GLGLREDFFDSKFMDPMCELNIKHYPSPTTTGKKSHLLIEHADFCAITLLYQDGVGGLQIRGLSGELMDVPPVEGSFVVN 238
84043930  159 AIGLQEDFFDSKFMDPLCELNIKHYVPLSQTKEETTLLIEHSDFGVMTLLYQDASGGLQVRDSSGELMDVPPVEGSFVVN 238
84043926  159 AIGLQEDFFDSKFMDPLCELNIKHYVPLSQTKEETTLLIEHSDFGVMTLLYQDASGGLQVRDSSGELMDVPPVEGSFVVN 238
73536520  157 ALDIDENFFVSKFHEPLSVFRMIHYPALPD-EKGRVVCGAHTDYGIVTLLYQDKVGGLQVQNLQGEWMDAPSLEDSYVVN 235
72388818  160 AIGLKKDFFDTKFDEPLSVFRMLHYPPQKQGTRYPIVCGEHTDYGIITLLYQDSVGGLQVRNLSDEWVDVEPLEGSFVVN 239
146092871 157 ALDIDEDFFVSKFHEPLSVFRMIRYPALPE-EKGRVVCGAHTDYGIVTLLYQDKVGGLQVQNLQGEWMDAPSLEGSYVVN 235
154340892 157 ALDIDEGFFVSKFHEPLSVFRMIHYPALPD-EKGRVVCGEHTDYGIVTLLYQDKAGGLQVKNAQGEWVDAPPVEGSYVVN 235
72392152  240 IGDMMNMWSNGRYRSTAHRVRLTTTDRYSMPYFCEPDPYTLIECLDHCHSPSNPPKYPPVRAVDWLLKRFEETYAHRKAN 319
71403139  239 IGDMMNMWSNNRYRSTPHRVVNPGVDRISMPFFCEPNPNVVIKCLENCHSAENPAKYPPVKASDWLQKRFAQTYAYRKSM 318
71746166  248 IGDMMEMWTNGRYRSTKHCVVSRGKERYSIPFFCNPNPNALVKCLDNCYSDTNPPKYPPVKASDWLLKRLADLYSYKSKM 327
71663652  239 IGDMMNMWSNNRYRSTPHRVVNPGVDRISMPFFCEPNPNVVIKCLENCHSAENPAKYPPVKASDWLQKRFAQTYAYRKSM 318
84043914  239 IGDMMEMWTNGQYRSTMHRVVPRSGTRYSMPFFCVPNPNVIIKCLDNCHSEENPPRYPPVRAVDWILKRFAEVFSLAKPK 318
84043922  239 LGDMMEMWTNGQYRSTKHRVVATDKERYSMPFFCNPNPNVIVKCLDNCHSEENPPRYPPVRAVDWILKRFAEAYGKDYSK 318
84043918  239 LGDMMEMWTNGQYRSTKHRVVATDKERYSMPFFCNPNPNVIVKCLDNCHSEENPPRYPPVRAVDWVLKRFAEAYGKDYSK 318
84043930  239 LGDMMEMWTNGQYRSTKHRVVATGKERYSMPFFCNPNPNVIVKCLDNCHSEENPPRYPPVRAVDWILKRFAEAYGKDYSK 318
84043926  239 LGDMMEMWTNGQYRSTKHRVVATDKERYSMPFFCNPNPNVIVKCLDNCHSEENPPRYPPVRAVDWVLKRFAEAYGKDYSK 318
73536520  236 IGDMMAMWSNGRYKSTLHRVINQGVERISMPFFCEPNPETTISCLPNCFDDANPSKFPDVKAADWLLKRFQQTYAYRADD 315
72388818  240 IGDMMNMWSNGRYRSTPHRVRLTTTDRYSMPFFCEPNPYTVIKCLDHCHSPSNPPKYPPVRAVDWLLKRFAETYAHRKTK 319
146092871 236 IGDMMAMWSNGRYKSTPHRVLNQGVERISMPFFCEPNPETTISCLPNCFDEANPSKFPDVKAADWLLKRFQQTYAYRADD 315
154340892 236 IGDMMAMWSNGRYKSTPHRVLSPGVDRISMPFFCEPNPETTISCLPNCFDEANPAKYPDIKAGDWLLMRFKQTYAYRADD 315
72392152  320 M 320
71403139  319 L 319
71746166      -    
71663652  319 L 319
84043914  319 M 319
84043922  319 M 319
84043918  319 M 319
84043930  319 M 319
84043926  319 M 319
73536520  316 L 316
72388818  320 M 320
146092871 316 L 316
154340892 316 V 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap