Conserved Protein Domain Family
PTZ00271

?
PTZ00271: PTZ00271 
hypoxanthine-guanine phosphoribosyltransferase; Provisional
Statistics
?
PSSM-Id: 140297
View PSSM: PTZ00271
Aligned: 3 rows
Threshold Bit Score: 429.828
Threshold Setting Gi: 157868946
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146080155   1 MSNSAKSPSGPVGDEGRRNYPMSAHTLVTQEQVWAATAKCAKKIAEDYRSFKLTTDNPLYLLCVLKGSFIFTADLARFLA 80 
154337142   1 MSGWTKSPFGPAGAAGPRSYPMSARTVITQEQVWAATAQCAKTIAQDYEKFKLAPENPLYLLCVLKGSFIFTADLARFLA 80 
157868946   1 MSNSAKSPSGIVGDEGRRNYPMSAHTLVTQEQVWAATAKCAKKIAEDYRSFKLTTGNPLYLLCVLKGSFIFTADLARFLA 80 
146080155  81 DEGVPVKVEFICASSYGTGVETSGQVRMLLDVRDSVENRHILIVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSG 160
154337142  81 DEGVPVRVEFICASSYGEGVETSGQVRMLLDVRDSVEDRHILIVEDIVDSAITLQYLMRFMLAKRPASLKTVVLLDKPSR 160
157868946  81 DEGVPVKVEFICASSYGTGVETSGQVRMLLDVRDSVENRHILIVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSG 160
146080155 161 RKVEVLVDYPVITIPHAFVIGYGMDYAESYRELRDICVLKKEYYEKPESKV 211
154337142 161 RKVKLLVDYPIIRVPDVFVIGYGMDFAESYRELRDVCELKKEYYLKPTSKL 211
157868946 161 RKVEVLVDYPVITIPHAFVIGYGMDYAESYRELRDICVLKKEYYEKPESKV 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap