Conserved Protein Domain Family
PTZ00269

?
PTZ00269: PTZ00269 
variant surface glycoprotein; Provisional
Statistics
?
PSSM-Id: 140295
View PSSM: PTZ00269
Aligned: 5 rows
Threshold Bit Score: 879.241
Threshold Setting Gi: 71746298
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71746310   1 MYWVVVLLTVLHSCHRALGKeDIVNQKEFEALCRMINWAEERLEHIKVTKRVTQEALKIGVRYLEVAGEEECRHIAKAQE 80 
71746304   5 MYWVVFLVAVLQGIHLVSGQ-DIVNQQEFEALCRMINWAERGLKHIKLAKQVTEEALSIGIRYLEVADADSAAQLGAAEH 83 
71746316   5 MYWVVFLVAALQGIHLVSGQ-DIVNQKEFEALCRIVNWAEKGLKQITLARQVTQEAQKIGVRYLEVVGEENAAELAKTQE 83 
71746298   5 MYWVVFLVAVLQGIHLVSGQeEILNEQEFEALCRMINWAERGLKHIKVTKRVTQEALKIGVRYLEVAGEENAAELAEAQD 84 
71746300   5 MYWVVFLVAALQGIHLVLGQeEILNEQEFEALCRMINWAERGLKHINLARQVTEEALKIGVRYLEVAGEEEVTELTELQE 84 
71746310  81 DSCT-KKMEDRKRNCGLYKNFWEEAQKAVKERAFSGEKLERKIDALGEHTVDEIKKKGMYGADIYHDVEAKRPSGNMRKM 159
71746304  84 DACM-DKREVREKNCGLYKTFWEESQRLLKEKHERSQAHHRGRNSLQYHTAEEIKSKVMEVADIFHEVKWELLELKVNNM 162
71746316  84 DSCA-YKREVGGRNCVLYKTFWQHAQEALKG-TARSSVHHRAMNTLEYHTIEKIKEKAMHGADIYHDVGAESLSVKVEKI 161
71746298  85 YSCT-KRMEDRKRNCGLYKTFWEEAQRVLNKGVDSGERPERKKNGLREHSAE-IRKKAMEVADIYHEIEAKSPSGQVEKI 162
71746300  85 KACMsNKKTSHEKNCGLYKTFWEESQEALKR-TARSQAPHRGRNSLQYHTAEGIKIKVMEVADTYHEVKKEILKLRTDNM 163
71746310 160 EEHLIKALYGMEYFSEDIKGGDsDRSRVCGQNLRNNKATGGWSLAVDLLCLCATHNSWKGRKkVCCADCSTGENRDEWNP 239
71746304 163 EEQLNQALYGRTYSAEEIRERE-ERSRVCGQSSRSEMIIGGQSLVMDLLCLCAMHSSWKEMR-VCCADCTTGENGNTWNP 240
71746316 162 ERKINQALYGMEYFTEEIKPGG-DRSRVCGQSSRSEMIIGGNSLAVDFLCLCAMHSSWNGIK-VCCTDCTTGENSNEWDP 239
71746298 163 EEQLNKALYGRTHTAEEIRERE-ERSRVCGKTLPNPPNREDQSLAVDLLCLCAMHGSWNGRE-ICCADCTTGRNSEEWNP 240
71746300 164 EEQLNQALYGVGHFTGEVKGGDsDRSRVCGQNLGNRDATGGWSLAVDLLCLCARHISWSSVKsVCCEECGTGENSNTWNP 243
71746310 240 ESNEAPRWDFLKQKCAGRHRNRHDMIEKLSEAEENLMKTVTKIGTIPYTHTYVLGTAVNSRIKPCGADINKQQEICVHYG 319
71746304 241 GSNGAPRWKFLKQKCAGATTSYVSVRKTLRGAKQDFMDAVTEISANRRTNLYKLGEKQNKEIKDCGADKNSKEGICVFYR 320
71746316 240 ESNGVQRWKFLKQKCADHNPNYYDTEKRLRNAKQNFMDTVTTIHGRGGRTLYKLGKKQSSEVNNCGAGTGRGQGICVLYK 319
71746298 241 ESNSAHRWEFLKQKCAGVIPSYGSTGERLRDAKQNFMDAVTKITTRRGEQLSKLGEKQNNNVKDCGADTSKSQGICMLYG 320
71746300 244 ALDGALHWEFLKENCPGDNTNHHTEGEQLKSAKKNFMAKVSKIATIPYRTMYKLGDSKNIQTKQCGANIGTGQGICVYYG 323
71746310 320 SDNGTKLpWLKALQKVEKEMKLTLKDKQDKSAKLKRMEELNQEIESLIRGDTGRGGQRGRQKRSVNPENSVPETPADPSD 399
71746304 321 ERDGVVF-WMKALENVDNKMEVLLQDRTKKTSKLERIKELSQEIESLIKGDTGRGRQQGRQKRSVDTENSVPETPADPSD 399
71746316 320 G-HGEELpWMKALVEVENEMEVLLQDKHNKSAKLERIKELSQEIEKLIKGDPGRGGQRGRQKRSVNPENSVPETPADPSD 398
71746298 321 AVDGVNLpWMKTLESVEDRIGLLMQESQDKTSKLERIKELSQEIESLIKGDTGRGRQQGRQKRSVDTENSVPETPADPSD 400
71746300 324 SDNGANLhWMQALERVENDVEVLLQDSKYKSTKLKRIKELSQEIQNLIEG----GTPRGRQKRSVDTENSVPETPADPSD 399
71746310 400 PTQSVPHTNEKKRSVRKPISTGNGATKSYNSEEDDSYEYECEGENSACSDSPAKPTVKNSKSAINCPLGLILLLV 474
71746304 400 PTQSTTHTNEKKRIVRKPISTGNNASKSYGGDEVDSYDSKCDGENSACSDSPAKPTVKSSKSAINCPLGLILLLV 474
71746316 399 PTQSVPHTNEKKRSVRKPISTGNGATKSYNSEEDDSYEYECEGENSACSDSPAKPTVKNSKSAINCPLGLILLLV 473
71746298 401 PTQSTTDTNRKKQGERKPISTGNGASKSYGGDEVDSYDSKCDGENSACSDSPAKPTVKSSKSAINCPLGLILLLV 475
71746300 400 PTQSTTHTNEKKRIVRKPISTGNNASKSYGGDEVDSYDSKCDGENSACSDSPAKPTVKSSKSAINCPLGLILLLV 474
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap