Conserved Protein Domain Family
PTZ00268

?
PTZ00268: PTZ00268 
glycosylphosphatidylinositol-specific phospholipase C; Provisional
Statistics
?
PSSM-Id: 140294
View PSSM: PTZ00268
Aligned: 6 rows
Threshold Bit Score: 629.227
Threshold Setting Gi: 84043898
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71404436   1 MLPESDDFTNNAWDPQSWMHDLRSFIGEMAITQVCLVGSHNAASYGTRKDSPFGADAPGFLLG-DSVFASLSRLLFRGIC 79 
71411136   1 MLPESDDFTNTEWHPQSWMHDLRSFIGEMAITQLCLLGSHNAASYGIRKDSPFVADAPGFLLG-DSVLASLSRFFFRGIC 79 
71408670   1 MLSESDDFTRTAWHPQSWMHDLRSFIGEMAITQLCLLGSHNAASYGIHNGSPFAKDAPGVLYE-NSFRGSLARLFSYRIS 79 
71654730   1 MLPGSDDFTNTEWHPQSWMHDLRSFIGEMAITQLCLLGSHDAASYGIHKDSPFGADAPGFLLG-DSVLASLSRFLFRGIC 79 
71421260   1 MLPESDDFTRTAWHPQSWMHDLRSQIGEMAITQVCFVGSHNAASYGIHKGSPFAKDAPGVLYE-NSFRGSLARLFSYRIS 79 
84043898   1 ------MFGGVKWSPQSWMSDTRSSIEKKCIGQVYMVGAHNAGTHGIQMFSPFGLDAPEKLRSlPPYVTFLLRFLTVGVS 74 
71404436  80 ASWSRCQWMSVRAQLDYGVRYLDLRVATNPEDASRLYISHTQISVPLADVLEDVKAFLNDPLSANEFIVLDFQHLYLTDD 159
71411136  80 ASWSKCQGMSVRAQLDYGVRYLDLRVATNPEDASRLYISHTQISVPLADVIEDVKAFLNDPSSANEFIVLDFQHLYLTDD 159
71408670  80 ASWAKCQGMSVRAQLNHGVRYLDLRVATNPKDAGRLYISHTQISVPLADVLEDVKAFLNDPSSANEFIVLDFHHLFLTDD 159
71654730  80 ASWSKCQGMSVRAQLDYGVRYLDLRVATNPEDANRLYTLHHLISVPLADVIEDVKAFLNDPSSANEFIVLDFQHLYLTDD 159
71421260  80 ASWAKCQGMSVRAQLDHGVRYLDLRVATNPKDASRLYISHAQISVPLAVVLEDVKAFLNDPLSANEFIVLDFHHLFLTDD 159
84043898  75 SRWGRCQNLSIRQLLDHGVRYLDLRMNISPDQENKIYTTHFHISVPLQEVLKDVKDFLTTPASANEFVILDFLHFYGFNE 154
71404436 160 SDGKGKFFKELERLSDRFIPVDVPLTTPLEMLWRVSRRRRIFLVVSSGEDELPYPAVRIRSKCMVSRWVDQGSLRKLLQA 239
71411136 160 SDGKGKFLGELDRLSDRFILVNVPLTTPLEILWRVSSRRRIFLVVSSGENGLPYPAARIRSKCMVSRWVDQGSLSKLLEA 239
71408670 160 SDGQGKFFRELDRLSDRFIPVDVPLTTPLEILWGTSREKRIFLVVAARRNMMPYPAARIRSKFMVSRWVNKCSLRELLQA 239
71654730 160 SDGKGKFFRELDRLSDRFILVNVPLTTPLEILWRVSSRRRIFLVVGSGEDESPYPAARIRSKCMVSRWVDENSLSKLLEA 239
71421260 160 SDGQGKFFRELDRLSDRFIPVDVPLTTPLAVLWRTSREKRIFLVVAARRNMMPYPAARIRSKCMVSRWVNKCSLRELLQA 239
84043898 155 SHTMKRFVEELQALEEFYIPTTVSLTTPLCNLWQST--RRIFLVV---RPYVEYPYARLRSVALKSIWVNQMELNDLLDR 229
71404436 240 LNNLLLDDLKYPQ-TGVPSKLHVTQAVYTPRKSNIFRGIFPKVSRKVVSSIYAVATRVNPSLLEWFYLLNAHGLLDGAKV 318
71411136 240 LDNLLLDDLKYPQ-TGVPSKLHVTQAVFTPRKSNIFIGILPKISRKVASSIYDVATRVNPSLLEWFYLLNANGLLDGMKV 318
71408670 240 LTNLLLDDLNHAP-SGSSSRLYVTQAVYTVCSCGVFRGIFPKVSSKVVSSIYDVAKRINSSLLEWFYSLNAHGLLDGAKV 318
71654730 240 LDNLLLDDLKYPQ-TGVPSKLHVTQAVLTPRYSDIFLGIFPKISRRIASSIYDMATCANPSLLEWFYLLNANGLLDGMKV 318
71421260 240 LTNLLLDDLNHAP-SGSSSRLYVTQAVYTVCSCDIFRGIFPKISSKAVSSIYDVAKRINPSLLEWFYSLNARGLLDGAKV 318
84043898 230 LEELMTRDLEDVSiGGVPSKMYVTQAIGTPRNNDFAVAACCGACPGSHPDLYSAAKHKNPHLLQWFYDLNVNGVMRGERV 309
71404436 319 MIPSGINTHGNILMLDCVELGRCQIMDGTTETNAVGMCVYLNFLRASRLCEDSSAAPFLKEG 380
71411136 319 MIPSGINTHGNILMLDCVELGRCQIMDGTTETNAVGMCVYLNILRASRLCEDSSVAPSLNEG 380
71408670 319 KIPPGINTHGNILMLDYVELGRCRIMDGTRETNAVGMCVYLNILRASRPRASSRQRPL---- 376
71654730 319 MIPSGINTHENILMLDCVELGRCQIMDGTTETNAVGMCVYLNILRASRLFEDSSAAPSLNEG 380
71421260 319 KIPPGINTHGNILMLDYVELGRCRIMDGARETNAVGMCVYLNILRASRPRASSPAAPALNEE 380
84043898 310 TIRRGNNTHGNILLLDFVQEGTCTVKGVDKPMNAVALCVHLNTNQTARS------------- 358
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap