Conserved Protein Domain Family
PTZ00267

?
PTZ00267: PTZ00267 
NIMA-related protein kinase; Provisional
Statistics
?
PSSM-Id: 140293
View PSSM: PTZ00267
Aligned: 5 rows
Threshold Bit Score: 1005.31
Threshold Setting Gi: 71663773
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154345339   1 MTAREgepnSASMELLNQYAKYFPHVLFTSHKAFEKYVASLDPEVYNNCVDLPEGEESLES--RNPQEHMYVLTTLVGRN 78 
71663773    1 MPNND----SHDAQLLRHYAQFFPNVLFTSEEEMEKYCQDARPDAVKKVLDLPEGEEVPEDamNDPRAHLYILKHIVGRN 76 
71659618    1 MPNND----SHDAQLLRHYAQFFPNVLFTSEEEMEKYCQDARPDAVKKVLDLPEGEEVPEDamNDPRAHLYILKHIVGRN 76 
72549995    1 MPAKEvehgSASTELLNQYAKYFPHVLFTSQEAFEKHAATLDPEVYKTCVDLPEGEESPES---NPREHMYVLTTLVGRN 77 
146102203   1 MPPKEvehgSASTELLNQYAKYFPHVLFTSDEAFEKHAATLDPEAYKNCVDLPEGEEPPES---NPREHMYVLTTLVGRN 77 
154345339  79 PTTAAFVATRCSVpAEKVVAKFVMLSDERQAAYARSELHCLAACTHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQ 158
71663773   77 ATTAAFVALRGSD-KQKVVAKFIMLNDEKQAAYARSEVHCLAACDHFGIVKHYDDLKSEDKLLLIMEYGSGGDLNKQIKQ 155
71659618   77 ATTAAFVALRGSD-KQKVVAKFIMLNDEKQAAYARSEVHCLAACDHFGIVKHYDDLKSEDKLLLIMEYGSGGDLNKQIKQ 155
72549995   78 PTTAAFVATRGSDpSEKVVAKFVMLNDDRQATYARSELHCLAACKHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQ 157
146102203  78 PTTAAFVATRGSDpSEKVVAKFVMLNDDRQATYARSELHCLAACKHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQ 157
154345339 159 RLKEHLPFQEYEVGLLFYQIVLALDEVHSRCMMHRDLKSANIFLMPTGIIKLGDFGFSKQYSDSVSLDVASSFCGTPYYL 238
71663773  156 RLKERLPFKEHEAGLLFYQIVLALDEVHSRKMMHRDLKSANIFLMPTGIIKLGDFGFSKQYTDSVSLDVGSSFCGTPYYL 235
71659618  156 RLKERLPFKEHEAGLLFYQIVLALDEVHSRKMMHRDLKSANIFLMPTGIIKLGDFGFSKQYTDSVSLDVGSSFCGTPYYL 235
72549995  158 RLKEHLPFQEYEVGLLFYQIVLALDEVHSRRMMHRDLKSANIFLMPTGIIKLGDFGFSKQYSDSVSLDVASSFCGTPYYL 237
146102203 158 RLKEHLPFQEYEVGLLFYQIVLALDEVHSRRMMHRDLKSANIFLMPTGIIKLGDFGFSKQYSDSVSLDVASSFCGTPYYL 237
154345339 239 APEVWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREILQQVLYGKYDPFPCPVSSTMKALLDPLLSKNPADRPTTQ 318
71663773  236 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGNYDPFPCGVSDGMKAVMEPLLSKDPALRPTTT 315
71659618  236 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGNYDPFPCGVSDGMKAVMEPLLSKDPALRPTTT 315
72549995  238 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGKYDPCPCPVSSSMQALLDPLLSKNPTERPTTQ 317
146102203 238 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGKYDPFPCPVSSSMQALLDPLLSKNPNERPTTQ 317
154345339 319 QLLHTEFLKYVANLFQDIVRHSETISPNDRTEILKQLQGSGERAPSPSSIRYDVLTSEVTHGGYLYKYSSDMRWKKRYFY 398
71663773  316 QLLHTELMKYVANIFEEIVRNSEVIEKHDKERILRQLAESRAKAPPPNSIQAGAVSNDVVREGYLLKYSSDMKWKKRYFS 395
71659618  316 QLLHTELMKYVANIFEEIVRNSEVIEKHDKERILRQLAESRAKAPPPNSIQAGAVSNDVVREGYLLKYSSDMKWKKRYFS 395
72549995  318 QLLQTEFLKYVANLFQDIVRHSETISPNDRAEILKQLQESGERAPLPSSIRYGVMTSQVTHGGYLYKYGSDCRWKKRYFY 397
146102203 318 QLLHTEFLKYVANLFQDIVRHSETISPSDRTEILRQLQESGERAPLPSSIRYGVMTSQVTHGGYLYKYGSDYRWKKRYFY 397
154345339 399 IGNGQLRISLSENPENDGVAPKSVNLETVSDAFPVPEVYSQKHPNQLVLWFNNGQKIIAYATTKEDRDVWISKFQRACGM 478
71663773  396 IKNGQLRISLTDNPEKDGVSPKSASLETVNDVFPVPEAYCRSNPHQLVIWFTNGQKIIAMAKSAEERDQWISDFQRACGM 475
71659618  396 IKNGQLRISLTDNPEKDGVSPKSASLETVNDVFPVPEAYCRSNPHQLVIWFTNGQKIIAMAKSAEERDQWISDFQRACGM 475
72549995  398 IGDGQLRISLSENPENDGVAPKSVNLETVGDVFPVPEVYSQKHPNQLVLWFNNGQKIIAYANTMEDRDMWISKFHRACGM 477
146102203 398 IGDGQLRISLSENPENDGVAPKSVNLETVGDVFPVPEVYSQKHPNQLVLWFNNGQKIIAYANTMEDRDMWISKFHRACGM 477
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap