Conserved Protein Domain Family
PTZ00266

?
PTZ00266: PTZ00266 
NIMA-related protein kinase; Provisional
Statistics
?
PSSM-Id: 173502
View PSSM: PTZ00266
Aligned: 2 rows
Threshold Bit Score: 1594.39
Threshold Setting Gi: 156103357
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156103357   1 MPGKYDDGESRLNEYEVIKKIGNGRFGEVFLVKHKRTQEFFCWKAISYRGLKEREKSQLVIEVNVMRELKHKNIVRYIDR 80  
221061569   1 MPSKYDDGESRLNEYEVIKKIGNGRFGEVFLVKHKRTQEFFCWKAISYRGLKEREKSQLVIEVNVMRELKHKNIVRYIDR 80  
156103357  81 FLNKANQKLYILMEFCDAGDLSRNIQKCYKMFGKIEEHAIVDITRQLLHALAYCHNLKDGPNGERVLHRDLKPQNIFLST 160 
221061569  81 FLNKANQKLYILMEFCDAGDLSRNIQKCYKMFGKIEEHAIVDITRQLLHALAYCHNLKDGPNGERVLHRDLKPQNIFLST 160 
156103357 161 GIRHIGKITAQANNLNGRPIAKIGDFGLSKNIGIESMAHSCVGTPYYWSPELLLHETKSYDDKSDMWALGCIIYELCSGK 240 
221061569 161 GIRHIGKITAQANNLNGRPIAKIGDFGLSKNIGIESMAHSCVGTPYYWSPELLLHETKSYDDKSDMWALGCIIYELCSGK 240 
156103357 241 TPFHKANNFSQLISELKRGPELPIKGKSKELNILIKNLLSLSAKERPSALQCLGYQIIKNVGPPvgaagVGAGVGAAPGA 320 
221061569 241 TPFHKANNFSQLISELKRGPDLPIKGKSKELNMLIKNLLNLSAKERPSALQCLGYQIIKNVGPP-----GGGGVAPMPGA 315 
156103357 321 -VARRNPSKEHPTLQLAAMEKAKHAEAANYGLSPNTLMNQRNEEQRGRRSSSCASRQSANNVTNitsitsvtsvasvasv 399 
221061569 316 vVTRRNPSKEHTGLQLATVENGKNGEDVNYGISQNVLINQRNEEQHGRRSSSSVSRQSVNNVTN---------------- 379 
156103357 400 asvpsKDERKYPQEGATHCHAVNGHYGGRVDKGHAERARIEKESAQRKALEMKILEKKRLER-ERVERERVERERMERIE 478 
221061569 380 -----KDDRKYPQDGGTNCHAVSGHYGGRVDKDHTERTRIEKENAHRKALEMKILEKKRIERlERERVERLERGRVERLE 454 
156103357 479 RERLerERLERERLerERLERDRLDRLER---DRLERDRLEKARRSSYFLKGMENGPSGGGGPGDGPGVGAgvgagvgtS 555 
221061569 455 RERV--ERLERERV--DRLERERVDRLERervDRLERDRLEKARRNSYYLKSMENGLSAGGVPTDGSSVGA--------T 522 
156103357 556 DGRSHSGVRSGIH----SSARSGVHESVRSGVHDSVRSGVHDSMRSGVHESLRSGVHDSIRSGAHDGVRSSAHDGVR--- 628 
221061569 523 EGRNHSGVRSSVHcsiqSSVRGGVHDSVRSGVHDSVRGGVHDSVRSGVHDSVRGSVHDSVRGGVHDSVRSGIPDNVRkss 602 
156103357 629 --------SGRARPPNQGTHGGNFSRGKDSSDHVSTYKPYAYDSRKAKNYQDTFDRSDMHGYMKNSSVSTTVPSSQMMHT 700 
221061569 603 gvkvegmgNARAPVPNQGTHDGSFSRGKDTSNHVSSYKPYIYDSRKEKNYQETFDRNEVHGYRKNSPITTIVPSSHVMQT 682 
156103357 701 QGNTPMNVNCKYLGGEAYGGYS-SHAATGPYITNSVESTKYRDHSRYS-GGLAKNAKEMYKEAVNSVCSAEAHYERVYNH 778 
221061569 683 KGNTGMSVNSKYLGGAGYGGYSnNHSATGQYVGNPMESVKYREHNKYSvVGLAKNAKEVYKETVNPICSTESQYERVYNH 762 
156103357 779 GSRGGPARTGSGRggdggrsidggrsidggrsiDGGRGGDERDGGTCKSNRVSNVYFNDNARRSVSALPHMNAINAKKAS 858 
221061569 763 GNRGGHTHSGSGS--------------------SGGERTDHRDGGTCKSNRVSNIYFNDNARRSVSALPHMNAINAKKSS 822 
156103357 859 LYNNTCDEGTLSKKGGEVDRSYQHLEKDREYLLEKRKMLVEKEKGIYDRLRHNNDYAYAPARGFDRSKD-KPNELDRRNR 937 
221061569 823 IYNNTCDEGTLSKKSVEVDRSYKHLEKDREYLLEKRKMLMEKEKGIYNRMRHNNDYAYAPVRAFDRGEDkKPNELDRRNR 902 
156103357 938 SLSMCMNEQEKRRDSATYNAkKEYHEEQEraEPASSYTVQKRNMYGMKNFAHNGPDAYTCR 998 
221061569 903 SLSMCMNEQEKRRGSSTYNV-KEYHDEEE--ELHNSYTLQKRNMYALKNFTHKGPDAYTCR 960 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap