Conserved Protein Domain Family
PTZ00264

?
PTZ00264: PTZ00264 
circumsporozoite-related antigen; Provisional
Statistics
?
PSSM-Id: 173500
View PSSM: PTZ00264
Aligned: 3 rows
Threshold Bit Score: 177.038
Threshold Setting Gi: 124804079
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124804079   1 MKILSVFFLaLFFIIFNKESLAEKTNkGTGSGVSSKKKNKKGSGEPLIDVHDLISDMIKKEEELVEVNKRKSKYKLATSV 80 
156098635   1 MKLLAAVFL-LFCAILCNHALGDNVN-GLGAGNPKKKSPKSKSPEPLIDVHELISEIVRKEEELVNMTKKKSNYKLATTV 78 
221056158   1 MKLLTAVFL-LFCAILCDHAFGNNIN-HSGPHHPKKKTPKSKAPEPLIDVHELIGEMVRKEEELINVTKKKSKYKLATTV 78 
124804079  81 LAGLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADNANPDADSESNGEPNAGPQVTAQDVTPEQPQ 150
156098635  79 LASALGVVSAVLLGGAGLVFYNAGNGRHPFSLGGGKGGDAAPTEPTPAPTAPSATGLNDDGSSSGTESTS 148
221056158  79 LASALGLVSAVLLGGAGLVFYNAGNGRHPFSLGGGKGGEAAPAESAPTVDEPATK--------------- 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap