Conserved Protein Domain Family
PTZ00263

?
PTZ00263: PTZ00263 
protein kinase A catalytic subunit; Provisional
Statistics
?
PSSM-Id: 140289
View PSSM: PTZ00263
Aligned: 14 rows
Threshold Bit Score: 654.58
Threshold Setting Gi: 154335603
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71414723    1 MKAGTTVTKEEVAEWQLHDLELGETIGTGTFGRVRLCKHKTSGKYMALKILKKQEVLRMKQVEHILAESSILQELNHPFI 80 
71659806   59 MSGEANYEKPDTSNWKLADFEMGDTLGTGSFGRVRIAKLKGTNDYYAVKCLKKREILKMKQVQHISQEKQILMELSHPFI 138
71659800    3 LKNAPEFVKPDASNWKLTDLEMGSTLGAGSFGRVRIAKLKGTNDYYAVKCLKKREILKMKQVQHIRQEKQILMELSHPFI 82 
71748896    1 MKSDGCLTRKDVSSWKLQDLEIRETIGTGTFGRVRLCRHRASGQYVVLKILKKQEILRMKQVDHILAESSILQELSHPFI 80 
71745510    6 TGDGQLFTKPDTSGWKLSDFEMGDTLGTGSFGRVRIAKLKSRGEYYAIKCLKKHEILKMKQVQHLNQEKQILMELSHPFI 85 
71745498    8 EPQTYVFTKPDTSGWKLSDFEMGDTLGTGSFGRVRIAKLKSRGEYYAIKCLKKREILKMKQVQHLNQEKQILMELSHPFI 87 
72549277   43 VKAAYYFAKPDTSSWKLSDFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMELCHPFI 122
146084101   1 -----MITKAEASKWRLSDLEMRETVGTGTFGRVRLVKHKGTGQYAALKILKKQEILRMKQVDHVMAEASLLQEIDHPFI 75 
146101775  54 PKVECNVTKPDTSSWKLSDFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMELCHPFI 133
146101797  43 VKAAYSFERPDTSSWKLSDFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMELCHPFI 122
71414723   81 VNMLKGFMDNDRLYILLEYVVGGELFTHLRKAGKFPNDVAKFYSAEVILAFEYLHNCNIVYRDLKPENLLLDAQGNIKIT 160
71659806  139 VNMMCSFQDDRRVYFVLEFVVGGEMFTHLRSAGRFPNDVAKFYHAEIVLAFEYLHSKDIIYRDLKPENLLLDSKGHVKVT 218
71659800   83 VNMMCSFQDDRRVYFVLEFVVGGEMFTHLRSAGRFPNDVAKFYHAEIVLAFEYLHSKDIIYRDLKPENLLLDSKGHVKVT 162
71748896   81 VTMYKGFMDDDRLYLLLEYVVGGELFSHLRKAGKFPNDVAKFYSAEVVLAFEYIHECGIVYRDLKPENVLLDKQGNIKIT 160
71745510   86 VNMMCSFQDENRVYFVLEFVVGGEVFTHLRSAGRFPNDVAKFYHAELVLAFEYLHSKDIIYRDLKPENLLLDGKGHVKVT 165
71745498   88 VNMMCSFQDENRVYFVLEFVVGGEVFTHLRSAGRFPNDVAKFYHAELVLAFEYLHSKDIIYRDLKPENLLLDGKGHVKVT 167
72549277  123 VNMMCSFQDEKKVYFLLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLDVIYRDLKPENLLLDNKGHVKMT 202
146084101  76 VSMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCAEVILAFDYLHNKTIVYRDLKPENILLDQDGNIKIT 155
146101775 134 VNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLDVIYRDLKPENLLLDNKGHAKVT 213
146101797 123 VNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLDVIYRDLKPENLLLDNKGHAKVT 202
71414723  161 DFGFAKRVTERTFTLCGTPEYLAPEVIQSRGHNKAVDWWALGILLYEMLVGYPPFFDESPFKIYEKILEGKLQFPRWVEA 240
71659806  219 DFGFAKKVPERTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRTYEKILSGRFKFPSWFDA 298
71659800  163 DFGFAKKVPERTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRTYEKILSGRFKFPSWFDA 242
71748896  161 DFGFAKRVRDRTYTLCGTPEYLAPEIIQSKGHDRAVDWWTLGILLYEMLVGYPPFFDESPFRTYEKILEGKLQFPKWVEM 240
71745510  166 DFGFAKKVTDRTYTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGHPPFFDETPIRTYEKILAGRLKFPNWFDE 245
71745498  168 DFGFAKKVTDRTYTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGHPPFFDETPIRTYEKILAGRFKFPNWFDS 247
72549277  203 DFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDG 282
146084101 156 DFGFAKRVTERTFTLCGTPEYLAPEIIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILVGKVLFPRWVDS 235
146101775 214 DFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDG 293
146101797 203 DFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDG 282
71414723  241 RAKDLIKGLLVLEPTKRLGSLNRGTQDVKRHKFYSGVDWDILLQKKVTPPIPVRLNKEGDTRYFDRYPESPRHPLPPLTA 320
71659806  299 RARDLVKGLLQTDHTKRLGTLKGGVADVKNHPYFHGANWEKLYARYYPAPIPVKAKSPGDTSNFERYPESQEDRAVPLTA 378
71659800  243 RARDLVKGLLQTDHTKRLGTLKGGVADVKNHPYFHGANWEKLYARYYPAPIPVKAKSPGDTSNFERYPESREDRVVPLTA 322
71748896  241 RAKDLIKSFLTIEPTKRLGSVKRGVQDVKRHKFYSGVNWNVLLQRGVAAPIHVRLNNDGDTRYFDRYPESPRHPLQPLTE 320
71745510  246 RARDLVKGLLQTDHTKRLGTLKDGVADVKNHPFFRGANWEKLYGRHYNAPIAVKVKSPGDTSNFESYPESGDKGSPPLTP 325
71745498  248 RARDLVKGLLQTDHTKRLGTLKDGVADVKNHPFFRGANWEKLYGRHYHAPIPVKVKSPGDTSNFESYPESGDKRLPPLAP 327
72549277  283 RARDLVKGLLQTDHTKRLGTLKGGPADVKNHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPALTS 362
146084101 236 KARDFIKGLLSLDPTKRLGSLPNGTEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFDKYPDSPLNSLRTLTP 315
146101775 294 RARDLVKGLLQTDHTKRLGTLKGGPADVKSHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPALTS 373
146101797 283 RARDLVKGLLQTDHTKRLGTLKGGPADVKSHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPALTS 362
71414723  321 KQQEMFAGF 329
71659806  379 TQQAEFIGF 387
71659800  323 TQQAEFIGF 331
71748896  321 AQQELFSGF 329
71745510  326 SQQVAFRGF 334
71745498  328 SQQLEFRGF 336
72549277  363 AQQAEFNGF 371
146084101 316 AQQDCFANF 324
146101775 374 AQQAEFKEF 382
146101797 363 AQQAEFNGF 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap