Conserved Protein Domain Family
PTZ00256

?
PTZ00256: PTZ00256 
glutathione peroxidase; Provisional
Statistics
?
PSSM-Id: 173495
View PSSM: PTZ00256
Aligned: 13 rows
Threshold Bit Score: 274.329
Threshold Setting Gi: 229594861
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118362818   1 MGSVLlscmQKSNLEEVKvsPAKDNFFAFEAIDNDGKLRKMSEFKNKKCILVVNVACKCGLTSDHYKQLVEIYKQYKSRG 80 
145475157   1 MGCLF----FKSAVDNLQ--PPKKSFFEFQLKDIDGVDTSLSKFKGKKVIICVNVACSCGLTSGNYSELVALYKKYSAQG 74 
145514730   1 MGSIF----FKKGVDKLQ--PPTKSFFDFELNNIDGQKTQLSQFKGKKAYICVNVACSCGLTSSNYSELVELYKTYSAQG 74 
145514087   1 MGSQL----FKKGVDKLQ--PPTKTFFEFELNNIDGQKTQLSQFQGKKAYICVNVACSCGLTSSNYSELVELYKSYSAQG 74 
145527724   1 MGICS----SKKELDKIE--VPSKSFFDFEINDIDGNLVQMSKFQGKKAYICVNVACSCRLTTQNYVELVEMYKQYKDQG 74 
118363356   1 MGSVLlscvQKKGLEQIKvsPAKDNFFAFEAVDNDGKLRKMSEFKNKKCILVVNVACKCGLTSDHYKQLVQIYKQYKSRG 80 
118355590   1 MGSLLfkavAKTDYENIK--PTQDNFFNYSAKDIDGNLRNMSEFKDRKCLLVVNVACKCGLTSDHYTQLVQLYKKYKSQG 78 
118379134   1 ----------MNGSEQIQ--SEATSLYDLSANNINGENTPLKNFNNKKAIIVVNVACQCGLTSDHYTQLVQLYKQYKSQG 68 
118397764   1 ---------MINGSEQIQ--SNASSLYELSAIDINGQNVSLKSFNNKKAIIVVNVACKCGLTSDHYTQLVGLYKQYKSQG 69 
118397766   1 ---------MINGSEQIQ--SNTSSLYELSAIDINGQNVSLKNFNNKKAIIVVNVACKCGLTSDHYTQLVGLYKQYKSQG 69 
118397768   1 ---------MINGSEQIQ--SNASSLYELSAIDINGQNVSLKSFNNKKVIIVVNVACKCGLTSDHYTQLVGLYKQYKSQG 69 
229596205   1 ---------MINGTEQIQ--SNTSSLYELSAIDINGQNVSLKNFNNKKAIIVVNVACKCGLTSGHYTQLVELYKQYKSQG 69 
229594861   1 ------------MADNIN----IASIFDVRAIDIDGNECQLSKFKGKKAYLIVNVASKCGFTSTNYKQLYEIYKNYSDKG 64 
118362818  81 FEILAFPTNDFMEQEPWDNNKIKEYVQTNFNVDFQLFDKIQVNGENCHEIYKFLRFNSELHDSKTGKTRQIPWNFAKFLI 160
145475157  75 LEILGFPCNQFMNQESKPEPEIKEFVIQKYGVSFPLFQKIEVNGPNTHELYQFLRLNSNNLRVSETSARQVPWNFGKFLL 154
145514730  75 LEILGFPCNQFMGQESKPEPEIKEFVLSKYGVSFPLFQKIEVNGQNTHEIYRYLRLNSSL-KTSANEAKEVPWNFGKFLL 153
145514087  75 LEILGFPCNQFMGQESQPEPEIKEFVISKYGVSFPLFQKIEVNGQNTHEIYRYLRLNSTL-KVNSNEAKEVPWNFGKFLL 153
145527724  75 LEILGFPCNQFRNQESKPEPEIKNYVTQKYGAHFPLFQKIEVNGVGAHDIYKYLRYNSELKINNKNEVKYVPWNFAKFLL 154
118363356  81 FEILAFPTNDFMEQEPWDNKKIKEYVQTNFNVDFQLFDKIQVNGENCHEIYKFLRFNSELHDSKTGKTRQIPWNFAKFLI 160
118355590  79 FEILAFPANQFMGQEPWDNAKIKEYVVTNFNVDFTLFDKVEVNGENCNEIFKFLRFNSELHNKETGKTRQIPWNFAKFLI 158
118379134  69 LEILGFPCNQFGAQEPWAESEILSYTQKTFNVEFPLFSKIDVNGENTHPVYKYLRRNSELFQNNA--ATKIPWNFAKFLV 146
118397764  70 LEVLAFPCNQFGEQEPWAESEILSYTQKTFNVDFPLFSKIDVNGENTHPIYKYLRRNSELFQNNS--ATKIPWNFAKFLI 147
118397766  70 LEILAFPCNQFGQQEPWAESEILSYTQKTFNVDFPLFSKIDVNGENTHPVYKYLRRNSELFQNNS--ATKIPWNFAKFLI 147
118397768  70 LEVLAFPCNQFGEQEPWAESEILSYTQKTFNVDFPLFSKIDVNGENTHPVYKYLRRNSELFQNNY--ATKIPWNFAKFLI 147
229596205  70 LEVLAFPCNQFGEQEPWAESEILSYTQKTFNVDFPLFSKIDVNGENTHPVYKYLRRNSELFQNNS--ATKIPWNFAKFLI 147
229594861  65 LEILAFPSNQFFNQEPFDEPAIKEFVKKEYNVDFPMFKKIYVNGEKRHDLYKYLANNTPGFQG------YIQWNFAKFLV 138
118362818 161 NPQ-GKVVKFVSPKYNPEVMIPDIEAMLDA 189
145475157 155 DSQ-GNVVAFFQPTQKPNEMIAQIEKLLSQ 183
145514730 154 NSQ-GQVVRFFNPDQKPKEMKQDIEKLLSQ 182
145514087 154 NSQ-GQVVKFYHPDIKPKEMLQEIEKLLNQ 182
145527724 155 DAN-GNVINYYCPDVSPNDMMKDIEKLLKN 183
118363356 161 DPE-GKVVKFVNPKHNPEVLIPDIEAMLNA 189
118355590 159 GPD-GKVHKFASPKVNPNDMIADIEAMLKA 187
118379134 147 DGKtGKVVQYFSPKVNPVEMEQQIKQLLL- 175
118397764 148 DGKtGKVISYFSPKVNPNEMEQQIKQLLQ- 176
118397766 148 DGKtGKVISYFNPKVNPNEMEQQIKQLLQ- 176
118397768 148 DGKtGKVISYFSPKVNPNEMEQQIKQLLQ- 176
229596205 148 DGKtGKVISYFSPKVNPNEMEQQIKQLLQ- 176
229594861 139 NAE-GKPVQYYEHKQNPVDIVPDILKLLNG 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap