Conserved Protein Domain Family
PTZ00251

?
PTZ00251: PTZ00251 
fatty acid elongase; Provisional
Statistics
?
PSSM-Id: 140278
View PSSM: PTZ00251
Aligned: 9 rows
Threshold Bit Score: 420.027
Threshold Setting Gi: 157866547
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154334209   1 MQWVDNWGANHYDGYAFKQWLLDNHDIAIYVAVGYITFVFQAPKLVSKYLnlpanaKTSPLVPVINKTWAVWNILLSAFA 80 
154334207   1 MQWLDNYGDQRYDGHAVQKWLASNVDVCVYIAGAYLAFVFTGPRVMEALF------HGKPSVAIIKKAWALWNLALSAFS 74 
154334211   1 MEALDNYLITHFDGHAVQTWLANNVDIGVYIAAAYLTFVFKGPQLVDFIF------SGNPPSKLIKMCWSLWNVGLAVFS 74 
146081423   1 MQWLDNYGDHHYDGHAVQMWLASNVDVCAYIAGAYLAFVFTGPRIMEALF------HGKPPMG-IKKAWALWNLGLSVFS 73 
146081427   1 MQWIDSWGANHYDGYAFKQWLLDNHDIAIYVAVGYITFVFQAPKLVSKYLnlpanaKSSPLVPVINKTWAVWNILLSAFA 80 
146081431   1 MEALDNYLIAHYDGHAVQKWLASNVDISVYIAAAYLTFVFKGPQLVDLIF------RGNPPTRLIKMCWTLWNIGLAVFS 74 
157866545   1 MQWLDNYGDHHYDGHAVQMWLASNVDVCAYIAGAYLAFVFTGPRLMEALF------HGKPPTG-IKKAWALWNLGLSVFS 73 
157866547   1 MQWIDSWGANHYDGYAFKQWLLDNHDIAIYVAVGYITFVFQAPKLVSKYLnlpanaKSSALVPVINKTWAVWNILLSAFA 80 
157866549   1 MEALDNYLIDHYDGHAVQKWLVNNVDIGVYIAAAYLTFVFKGPQLVDFIF------RGNPPTRLIKMCWTLWNIGLALFS 74 
154334209  81 FYGTTRVVPPLLYNLKTYGLHDTLCTFRPDEFYTSDVGVALGLFTISKVPEFGDTFFLVLKGT-KLRFLSWFHHTAMFLY 159
154334207  75 LYGWLRVAPPLLRHLMKDGMHDTLCTFHEDEFYTTKVGFAMGMFAISKVPEFIDTVFLLMRGV-NLSFLSWFHHVTTYLF 153
154334211  75 MYGVYHTIPLFINNLRRYGQKDTLCRFREDEFFTGKHGVAMGLFSLSKLPEFGDTFFLIMGGKrKLPFLSWFHHVTIFLY 154
146081423  74 LYGWLRVGPPLLRHLMNDGLHNTLCTFHEDEFYTTKVGFAIGMFAISKVPEFIDTVFLLMSGV-KLGFLSWFHHVTTYLF 152
146081427  81 FYGTTRVVPPLLYNLKTYGLHDTLCTFRPDEFYTSDVGVALGLFTISKVPEFGDTFFLVLKGT-KLRFLSWFHHTAMFLY 159
146081431  75 MYGVYHIVPLFINNLRKYGQKDALCRFREDEFYTGKNGVAMGLFSLSKLPEFGDTFFLIMGGKrKLPFLSWFHHVTIFLY 154
157866545  74 LYGWLRVGPPLLRRLMHDGLHNTLCTFHEDEFYTTKVGFAIGMFAISKVPEFIDTVFLLMSGV-KLAFLSWFHHVTTYLF 152
157866547  81 FYGTTRVVPPLLYNLKTYGLHDTLCTFRPDEFYTSDVGVALGLFTISKVPEFGDTFFLVLKGT-KLRFLSWFHHTAMFLY 159
157866549  75 MYGVYHTVPLFINNLRKYGQKDTLCRFRDDEFYTGKNGVAMGLFSLSKLPEFGDTFFLIMGGKrKLPFLSWFHHVTIFLY 154
154334209 160 VWLSYETGSSTLICAAAMNYFVHTIMYFYFFLSEAGFKSLARPFAMYITLLQLAQMVGVMFVSGYVIVQKYIladqgitD 239
154334207 154 VWYSYQQGTSIFICAAAMNYFVHSIMYFYFFLSEAGFKSLVKPFAMYITLLQITQMVGGLFVSGYVLLQKLTe-----gT 228
154334211 155 AWMAYQQASSIWIVLASINYFVHSIMYTYFALAEAGFKSLVKPFAMYITLLQITQMVVGLYFTVSFIVHH---------K 225
146081423 153 AWYSYQQGTSIFICAAAMNYFVHSIMYMYFALSEAGYKKLVKPFAMYITLLQIAQMVGGLFVSGYVLAQKLT-------E 225
146081427 160 VWLSYETGSSTLICAASMNYFVHTIMYFYFFLSEAGFKNLARPFAMYITMLQLVQMVGVMFVSGYVIAQKYIlagqgimD 239
146081431 155 AWMAYQQASSIWIVLASINYFVHSIMYTYFALAEAGFKKLVKPFAMYITLLQIAQMVVGLYFTFSFISYH---------K 225
157866545 153 AWYSYQQGTSIFICAAAMNYFVHSIMYMYFALSEAGFKKLVKPFAMYITLLQITQMVGGLFVSGYVLVQKLT-------E 225
157866547 160 VWLSYETGSSTLICAAAMNYFVHTIMYFYFFLSEAGFKNLARPFAMYITMLQLVQMVGVMFVSGYVIAQKYIlagqgimD 239
157866549 155 AWMAYQQASSIWIVLASINYFVHSIMYTYFALAEAGFKKLVKPFAMYITLLQITQMVVGLYFTFSFISYH---------K 225
154334209 240 GMTGSCSGTTMATARLQLGIYTAFLYLFGEMFMNNHVRPRAAKKAD 285
154334207 229 SKPKTCSGTSISTARTQLVIYIFNFYLFSEMFVKGYVLPRKAPAGE 274
154334211 226 ADPQGCNGSTMALARGQCMIYIFNFYLFSEMFVKGYVLPRKAPAGE 271
146081423 226 NAANACSGTSMSAARTQLVIYIFNFYLFSEMFIKAYVLPRKASVAP 271
146081427 240 GMEGSCSGTTMATARLQLGIYTAFLYLFGEMFVNNHVRPRAAKKVD 285
146081431 226 ADPKGCNGSTMALARGQCMIYFFNLYLFSEMFIKGYVLPRKAAAGD 271
157866545 226 GAGNPCSGTSMSAARTQLVIYIFNFYLFSEMFIKAYVLPRKAGAAL 271
157866547 240 GMEGSCSGTTMATARLQLGIYTAFLYLFGEMFVNNHVRPRVAKKAD 285
157866549 226 ADPKGCNGSTMALARGQCMIYFFNFYLFSEMFIKGYVLPRKAAAGE 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap