Conserved Protein Domain Family
PTZ00250

?
PTZ00250: PTZ00250 
variable surface protein Vir23; Provisional
Statistics
?
PSSM-Id: 140277
View PSSM: PTZ00250
Aligned: 2 rows
Threshold Bit Score: 567.295
Threshold Setting Gi: 156093010
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156093010   6 IHYPXIERTGDkepaSSEVYTLIKNLTLYEFYELLDNELVKNYEP----DDRCNHCKNQIASDQTNGAELIDLCKKCCNI 81 
156092257   1 MSYLSLLYSGE----NKETYSILKNLNLYDFYEKLDNELDKKIEEtpeiKQKCDYCQGHIASQAENGEKLIELCKKICNI 76 
156093010  82 ILNVNNILDKYKSSDDKKKCQYMSHWLYDKVVSITQGTNLFINFYAVLSMYSSSNKDNFKNCTLKNFKVDKEAFNKKHIL 161
156092257  77 ILNVHGILNKCNDRTDNKACSYMEYWLYYNVTRYTEEQNIVSKFYALVSMYTTFKSSNFNNCSLTNFAIDKNIFDIKRTL 156
156093010 162 YEFIESYDDMKNKIDNKSKLYTPLYCKHIKENFLFYNVVKNECTSNESCGYFNELNEFKEKFRQQDVLSFIYEKCEYTKT 241
156092257 157 YEFIEIYEGIKNEILQENNVNVKTYCKHIKENFRYYNIIKESCKSKDTCDYYDEYIQFKNKFKEPSVINLICEKCDYIKT 236
156093010 242 SCKHGSNSEDDVPCLQAKGIPFILPILGNDPDDIINILLNVAIISVPFLAIFLILFKFTPFGRKLNRINAKGRKSGSKKK 321
156092257 237 SCQKGSNGEDDVPCLREKGXSFLYXJFGNDADNIINILLKVTTISAPILALFVILFKFTPFGKNLNKLKQERKKSGHKKK 316
156093010 322 EENIEDYMNNYAAYVDNVMKNRVNLTYHAS 351
156092257 317 EVNIQDYMKNYAAHLDSEMKNRVHLGYHAT 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap