Conserved Protein Domain Family
PTZ00249

?
PTZ00249: PTZ00249 
variable surface protein Vir28; Provisional
Statistics
?
PSSM-Id: 140276
View PSSM: PTZ00249
Aligned: 3 rows
Threshold Bit Score: 912.492
Threshold Setting Gi: 156092479
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156092982   1 MATNPQ---YIKYQDYYIVKKSFVYTPTDEFNISFVNALIKDIRNTPTKEKLLYKTFYELKKFISRNHSFLEYGKEKCCN 77 
156092479   1 MSRNPPtlwYFNYHDYTEIKNIFDYTPSDIYDVIVANDLIKPISNTTPKELELLKTFNDLKKMILRHPCVIRHGQETCCN 80 
156092890   1 MATNPQ---YIKYQDYYIVKKSFDYTPTDEFNISFVNALIKDIRNTPTKEKLLYKTFYELKKFVKRHHCFMYYDKENCYK 77 
156092982  78 YINYWLNKTVRDSEYGVNKEKFKFFDEFMQRDPKASDGPFNCISKLSYMDTDSFQKMKKLYDLYDYFTELKEHEDSSTLC 157
156092479  81 YINYWLNKTVRDSEYNVNKQNFNIFDKFMQDDPKIKEGPTTCKSKLSYMDTDTFKKMEKLYDLYDYFTKLKESKVPTTLC 160
156092890  78 YINYWLNKTIRDSNYNITKENFKVFYDFKNYDPDDNADLFDSISKLRYMDTDSFQKMEKLYGLYDYFTEQKESHDSSSLC 157
156092982 158 RSISDLAKKYESMMREY-EKDNKLCNMLTNLRGVIERDKLVAKDICEKNTFDSFILKIDPPREEQKEVTAHAYRGISGEA 236
156092479 161 HNISDLTEKYESVFKECnGKDNNLCDKLTNLKNVIVKDKLVANNICTKEAFDSFILKIDPPREEQKAVTAPAHRRISGEA 240
156092890 158 RNISKIAEKYKSMMQEYkEKDHKLCEVLTNLKDIIESDKLVAKNICTKNTSDLFYLKIDPPREEQKAVSAHAQRRISGEA 237
156092982 237 RPPkhssvsspqvhrgisvetrptNPVSASLPQAHGRSPGETHTRPLVTAPSSRVHDRNSVQTPTPTXVSVSLSQAKGLE 316
156092479 241 RPP---------------------NPVSVSSLQVHGRHPGKTHPPKHVSVPSQKAHGRHPGEKPTPPSVSGYSSPAQGLE 299
156092890 238 RPPkhisfssphahgrppvetrppNPVSVSSPQAHGRPPGETHTPPLVTVPSSHAHDRNTVQTSTPTPVSEYSSQAKGLE 317
156092982 317 KPAGGESERTLSVPQEQSPRPLPlLLPLPSLEQSDPLESSEADEYGGPKGL-------TETESELRQEPQDEERYQLERD 389
156092479 300 TQARVESERTSSVPSEQFPLPLP-LLPLGQSGPLESSETEETDEYARPKGL-------PEPELPQVELQEEDQVHGLKHD 371
156092890 318 KQAGGESERTSSVLPKRFPLPVPvVLS----------ESTETEEETGPMGPyrisgqePEPEPELELPQEQGRRIDTLTD 387
156092982 390 VDPFNEDEEYTSLQEVDPPAGSMQSTFDTGTIMGTIKGAVSNVLGAVEPVPVLGVSGGMGALYLLLKYTPVGSLFGRNRR 469
156092479 372 VDTFREVEEDTFLQEGDQPAGSTMPTYDTGTIMGTIKGAVYNVLEAVEPVPVLGVSGGMGALYLLLKCTPIGSLFRRNRR 451
156092890 388 SYYFRED-------EGDLRAGSMQSTFDTGTIMGTIKDAVSNVLEAVEPVPVLGVSGAIGALYLLFKYTPIGSLFRRNRR 460
156092982 470 NNQYIPNFYDPGYREQYSDYYPEYYNEDFPNNRMNIAYHPSSYELD 515
156092479 452 NNQNIPNFFDPRYGEQFSGYYPQYYNEGFSNYRMNIAYYPSSEELD 497
156092890 461 NNQNIPNFFDPEYGEQFSGYYPQYYNEGFPNYRMNIAYHPSSEELD 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap