Conserved Protein Domain Family
PTZ00246

?
PTZ00246: PTZ00246 
proteasome subunit alpha; Provisional
Statistics
?
PSSM-Id: 173491
View PSSM: PTZ00246
Aligned: 9 rows
Threshold Bit Score: 456.622
Threshold Setting Gi: 156101261
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71029642    1 MSRRYDSRTTTFSPEGRLYQVEYALEAINNASLTVGVLCSSGVVLVADKPISSKLLDPGKINEKLYKLDSHIFCAVAGLT 80 
66356910   11 MSRRYDSRTTTFSPEGRLYQVEYALEAINNAAPTVGILCKEGVILGADKAIVSKLLDQGKSLEKIYTIDRHIIAAVAGLT 90 
84997473    1 MSRRYDSRTTTFSPEGRLYQVEYALEAINNASLTVGVLCNSGVVLVADKPISSKLLDPGKINEKLYKLDSHIFCAVAGLT 80 
124513788   1 MARRYDSRTTTFSPEGRLYQVEYALEAINNASITIGLITKDGVILGADKVFISKLIDKANNYEKIYKIDKHIFCGVAGLN 80 
156101261   1 MARRYDSRTTTFSPEGRLYQVEYALEAINNASITIGIITNEGVILGADKVFISKLIDKANNFEKIYKIDKHIFCGVAGLN 80 
156089275   1 MSRRYDTKTTTFSQEGRLYQVEYALEAINNANLTVGLLCDLGVVLAADKPISTPLLDPGKINEKLYKLDSHMFCAVAGLT 80 
209878941   1 MSRRYDSRTTTFSPDGRLYQVEYALEAINKAAPTIGILCKDGVILAADKAVVSKLLDPGRTLEKLYTIDNHIICAVAGLT 80 
221057694   1 MARRYDSRTTTFSPEGRLYQVEYALEAINNASITIGIITSEGVILGADKVFISKLIDKANNFEKIYKIDKHIFCGVAGLN 80 
67587330    1 MSRRYDSRTTTFSPEGRLYQVEYALEAINNAAPTVGILCKEGVILGADKAIVSKLLDQGKSLEKIYTIDRHIIAAVAGLT 80 
71029642   81 ADANVLINMCKLYAQRHRYSYGEPQSIEQHIIQICDLKQSYTQFGGLRPFGVSFLFGGWDENLGFQLYHTDPSGNYSGWK 160
66356910   91 ADANILIAQARIDSQRYQYTYGEEQPVEQLVTQICDRKQSYTQFGGLRPFGVSFLFAGYDKNYGYQLYQSDPSGNFSGWK 170
84997473   81 ADANVLINMCKLYAQRHRYSYGEPQSIEQHIIQICDLKQSYTQFGGLRPFGVSFLFGGWDENLGFQLYHTDPSGNYSGWK 160
124513788  81 ADANILINQSRLYAQRYLYNYNEVQPVSQLVVQICDIKQSYTQYGGLRPYGVSFLIGGYDTKDGYQLYHTDPSGNYSGWF 160
156101261  81 ADANILINQSRLYTQRYLYNYNDVQPVSQLVVQICDIKQSYTQYGGLRPYGVSFLIAGYDVKEGYQLYHTDPSGNYSGWF 160
156089275  81 ADATVLINTCKLYAQRHRYAYGEPQDVEQHVVQICNLKQSYTQFGGLRPFGVSFLFAGWDSHLGFQLYHTDPSGNYSGWK 160
209878941  81 ADANILISQARIDAQRYQYTYGERQPVEQLVIQICDRKQSYTQFGGLRPFGVSFLFAGYDHYHGYQLYQSDPSGNYSGWM 160
221057694  81 ADANILINQSRLYTQRYLYNYNDVQPVSQLVVQICDIKQSYTQYGGLRPYGVSFLIAGYDVKEGYQLYHTDPSGNYSGWF 160
67587330   81 ADANILIAQARIDSQRYQYTYGEEQPVEQLVTQICDRKQSYTQFGGLRPFGVSFLFAGYDKNYGYQLYQSDPSGNFSGWK 160
71029642  161 ATAIGMNSQSAQSILKQEWKEDLTLEQAVRLAIRVLTKAMDSSTPQADKIEVGVLSKGETgEFEPFVEMLNNDKVDTLLK 240
66356910  171 ATAIGQNNQTATSLLKQEWNEDLTLEQGLHLVAKVLTKTMDTTSPTADKFEFSILTHNNE-SNKCSQKILSEKEIGELLE 249
84997473  161 ATAIGMNSQSAQSILKQEWKEDLTLEQAIKLAIRVLTKAMDSSTPQADKIEVGVLSKGETgEFEPFVEMLNNERVDTLLK 240
124513788 161 ATAIGTNNLTASSVLKQEWKNDMTLEEGLLLALKTLAKSTDTEIPKSEKIELAYLTNK---DGEVYQKYLTEKEIEELIK 237
156101261 161 ATAIGTNNLTASSILKQEWKKDMTLQDGLLLALKTLAKSTDSEVPKSEKIELAYLSNK---DGELIQKYLTEKEIAELVK 237
156089275 161 ATAIGHNSQPAQSMLRQEWKEGMNLDEALYLAVKVLTKSMDSTMPKADKIEVGMLWRGPNgDGEPTVEMVSESRVAEILS 240
209878941 161 ATAIGQNNQTATSMLKQEWKNDLSVDEGLLLIAKVLTKTMDTTSPSANKLEFSILKHDD--KFGCIQKILSHDEIQAILN 238
221057694 161 ATAIGTNNLTASSILKQEWKKDMTLQDGLLLALKTLAKSTDSEVPKSEKIELAYLSNK---DGELIQKYLTEKEIAELVK 237
67587330  161 ATAIGQNNQTATSLLKQEWNEDLTLEQGLHLVAKVLTKTMDTTSPTADKFEFSILTHNNE-SNKCSQKILSEKEIGELLE 239
71029642  241 SIAQEDVKPNQPNN 254
66356910  250 KVQKEIASENNAKN 263
84997473  241 TIAQEDTNKSTNTQ 254
124513788 238 LYTQKYIKE----- 246
156101261 238 VYTEKYVKE----- 246
156089275 241 KLTDEAAAKAVESG 254
209878941 239 KVQVENSSENTNN- 251
221057694 238 VYTEKYVKE----- 246
67587330  240 KVQKEIASENSAKN 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap