Conserved Protein Domain Family
PTZ00245

?
PTZ00245: PTZ00245 
ubiquitin activating enzyme; Provisional
Statistics
?
PSSM-Id: 140272
View PSSM: PTZ00245
Aligned: 4 rows
Threshold Bit Score: 456.057
Threshold Setting Gi: 157871530
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154340229   1 MIDAEAVRYDRQIRLWGKATQQQIMHTSVALHGIAGAAAEVTKNLVLAGVRAVAVADEGHVTDVDVCTNYLMQGEGGGTR 80 
146091599   1 MREAEAVRYDRQIRLWGKSTQQQLMHTSVALHGVAGAAAEAAKNLVLAGVRAVAVADEGLVTDADVCTNYLMQGEAGGTR 80 
146096029   1 MREAEAVRYDRQIRLWGKSTQQQLMHTSVALHGVAGAAAEAAKNLVLAGVRAVAVADEGLVTDADVCTNYLMQGEAGGTR 80 
157871530   1 MRDAEAVRYDRQIRLWGKSAQQQLMHTSVALHGVAGAAAEAAKNLVLAGVRAVAVADDGLVTDADACTNYLMQGEAGGTR 80 
154340229  81 GARALSALQRLNPYVTVYDAVTKLDGSSGPRVTMATVASVEDAVPHAHAAVPGADIVALHVTCGPTVLALFLYRRLPARS 160
146091599  81 GARALGALQRLNPHVSVYDAVTKLDDSSGTRVTMAAVITEEDAVPHVQAALPCADIVALHATCGPTVLALFLYRRLPAHS 160
146096029  81 GARALGALQRLNPHVSVYDAVTKLDDSSGTRVTMAAVITEEDAVPHVQAALPCADIVALHATCGPTVLALFLYRRLPAHS 160
157871530  81 GARALGALQRLNPHVSVYDAVTKLDGSSGTRVTMAAVSTEEDAVPHVQAALPCADIVALHVTCGPTVLALFLYRRLPVHS 160
154340229 161 LAEQWRCLVAEPSLLAEKPRGYQRVVLALHVRTDAVSLGFAAAAAKAYEVVERLHLQQLTAADVQEVLQSCAHDAGSGDC 240
146091599 161 LAEQWRCLVAEPSLLAEKPRGYQRAVLALHVRTEAVSLGFAAAAAKAYEVVSRLQLQQLTAADVQEVLQTCAHGAGSADC 240
146096029 161 LAEQWRCLVAEPSLLAEKPRGYQRAVLALHVRTEAVSLGFAAAAAKAYEVVSRLQLQQLTAADVQEVLQTCAHGAGSADC 240
157871530 161 LAEQWRCLVAEPSLLAEKPRGYQRAVLALHVRSKAVSLGFAAAAAKAYEVVSWLQLQQLTAADVQEVLQTYAHGAGSADC 240
154340229 241 VSDTIAGACIAQHLIRQISALDQPPDAQSYHWMLCECGAEVECLVGL 287
146091599 241 VSDTIAGACIAQHLIRQIGALNQPPDAQSYHWMLCECGAEVECLVGL 287
146096029 241 VSDTIAGACIAQHLIRQIGALNQPPDAQSYHWMLCECGAEVECLVGL 287
157871530 241 VSDTIAGACIAQHLIRQIGALNQPPGAQSYHWMLCECGAEVECLVGL 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap