Conserved Protein Domain Family
PTZ00244

?
PTZ00244: PTZ00244 
serine/threonine-protein phosphatase PP1; Provisional
Statistics
?
PSSM-Id: 140271
View PSSM: PTZ00244
Aligned: 18 rows
Threshold Bit Score: 594.576
Threshold Setting Gi: 72388178
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71406951    1 MSLVHNLLEKMLTLTKSATQRQILIREEDIRSVLDSVRDVFMSQPMLLEIRPPVRICGDTHGQYYDLMRIFEKCGFPPYS 80 
71406953    1 MSLAHNLLEKMLTLTKSATQQQILIREEDIRSVLDSVRDVFMSQPMLLEIRPPVRICGDTHGQYYDLMRIFEKCGFPPYS 80 
71649301    3 SNVVHNLIERLLTVKGSNTQRQILIREEDIRSVLNSVRDVFMSQPMLLEIRAPVRICGDTHGQYYDLMRIFEKCGFPPYS 82 
71649303    1 MSLAHNLLEKMLTLTKSATQQQILIREEDIRSVLDSVRDVFMSQPMLLEIRPPVRICGDTHGQYYDLMRIFEKCGFPPYS 80 
72388176    1 MTLVQTLLERMLSAKGSATQQQILIREEDIRTILNTVRDVFMSQPMLLEITPPVRICGDIHGQYYDLLRVFEKCGFPPYS 80 
72388178    1 MTLVQTLLERMLSAKGNTAQRQILIREEDIRTILNAVRDVFMSQPVVLDITPPVRICGDIHGQYYDLLRVFEKCGFPPYS 80 
146083187   6 FPLVQSIVEKMLTGGDNRFQRQILIKEEEIRAVLRAVREVFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYS 85 
146083190   7 LPMVQTLIEKMLTVKGNRMQRQILIKEEEIRAVLTEVREIFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYS 86 
154336247   7 FPMVQTLIEKMLTVKGNRMQRQILIKEEEIRAVLTEVREIFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIFEKCGFPPYS 86 
157875569   6 FPLVQSIVEKMLTGGDNRFQRQILIKEEEIRAVLRAVREVFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYS 85 
71406951   81 NYLFLGDYVDRGKHSVETITLLYCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVV 160
71406953   81 NYLFLGDYVDRGKHSVETITLLYCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVV 160
71649301   83 NYLFLGDYVDRGKHSVETITLLYCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVV 162
71649303   81 NYLFLGDYVDRGKHSVETITLLYCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVV 160
72388176   81 NYLFLGDYVDRGRHSVETITLLFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVV 160
72388178   81 NYLFLGDYVDRGRHSVETITLLFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNAKLFKAFTDVFNTMPVCCVV 160
146083187  86 NYLFLGDYVDRGKHSVETIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVI 165
146083190  87 NYLFLGDYVDRGKHSVETIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVI 166
154336247  87 NYLFLGDYVDRGKHSVENIILLYCYKIVYRENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVI 166
157875569  86 NYLFLGDYVDRGKQSVETIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVI 165
71406951  161 SEKIICMHGGLSPDMTSLATVNEIERPCDVPDKGILCDLLWADPEDEVRGFLESDRGVSYLFGEDIVSDFLDMVDMDLVV 240
71406953  161 SEKIICMHGGLSPDMTSLATVNEIERPCDVPDKGILCDLLWADPEDEVRGFLESDRGVSYLFGEDIVSDFLDMVDMDLVV 240
71649301  163 SEKIICMHGGLSPDMTSLATVNEIERPCDVPDKGILCDLLWADPEDEVRGFLESDRGVSYLFGEDIVSDFLDMVDMDLVV 242
71649303  161 SEKIICMHGGLSPDMTSLATVNEIERPCDVPDKGILCDLLWADPEDEVRGFLESDRGVSYLFGEDIVSDFLDMVDMDLVV 240
72388176  161 SEKIICMHGGLSPDMTSLASVNEIERPLDVPDKGILCDLLWADPEDEVKGFLESDRGVSYLFGEDIVTDFLDMVDMDLVV 240
72388178  161 GEKIICMHGGLSPDMTSLACVSEIERPLDVPDKGILCDLLWADPEEEVKGFLESDRGVSYLFGEDIVTDFLDMVDMDLVV 240
146083187 166 SEKIICMHGGLSPDLTSVASVMDIERPCDVPDRGILCDLLWADPEDDVQGFLESDRGVSYLFGEDIVNDFLDMVDMDLIV 245
146083190 167 SEKIICMHGGLSPDLTSVASVMDIERPCDVPDRGILCDLLWADPEDDVQGFLESDRGVSYLFGEDIVNDFLDMVDMDLIV 246
154336247 167 SEKIICMHGGLSPDLTSVASVMDIERPCDVPDRGILCDLLWADPEDDVQGFLESDRGVSYLFGEDIVNDFLDMVDMDLIV 246
157875569 166 SEKIICMHGGLSPDLTSVASVMDIERPCDVPDRGILCDLLWADPEDDVQGFLESDRGVSYLFGEDIVNDFLDMVDMDLIV 245
71406951  241 RAHQVMERGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVDEKLQCSFLIIPAR 294
71406953  241 RAHQVMEHGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVDEKLQCSFLIIPAR 294
71649301  243 RAHQVMERGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVDEKLQCSFLIVPAN 296
71649303  241 RAHQVMEHGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVDEKLQCSFLIIPAR 294
72388176  241 RAHQVMERGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVDEKLQCSFLIIPAR 294
72388178  241 RAHQVMERGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVDEKLQCSFAIIAAR 294
146083187 246 RAHQVMERGYGFFASRQLVTVFSAPNYCGEFDNDAAVMNIDDKLQCSFLIIPAS 299
146083190 247 RAHQVMERGYGFFASRQLVTVFSAPNYCGEFDNDAAVMNIDDKLQCSFLIIPAI 300
154336247 247 RAHQVMERGYGFFASRQLVTVFSAPNYCGEFDNDAAVMNIDDKLQCSFLIIPAS 300
157875569 246 RAHQVMERGYGFFASRQLVTVFSAPNYCGEFDNDAAVMNIDDKLQCSFLIIPAS 299
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap