Conserved Protein Domain Family
PTZ00240

?
PTZ00240: PTZ00240 
60S ribosomal protein P0; Provisional
Statistics
?
PSSM-Id: 140267
View PSSM: PTZ00240
Aligned: 10 rows
Threshold Bit Score: 587.314
Threshold Setting Gi: 71668474
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71754749    1 MPSVSQEKRDYEDRLNGCLTKYSRVLFCLMDNVRSQQVHGVRRDLRGKGELVMGKKTLQKKIVEKRAEGNKATDADKLFH 80 
71668472    1 MPSVSEAKREYEERFNGCLTKYGRVLFCLMDNVRSQQVHDVRRDLRGLGELVMGKKTLQKKIVERRAEDKKASAYDKLLY 80 
71668474    1 MPSVSKAKREYEERFNGCLTKYGRVLFCLMDNVRSQQVHDVRRDLRGLGELVMGKKTLQKKIVERRAEDKKASAYDKLLY 80 
71754751    1 MPSVSQEKRDYEDRLNGCLTKYSRVLFCLMDNVRSQQVHGVRRDLRGKGELVMGKKTLQKKIVEKRAEGNKATDADKLFH 80 
73544403    1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFMMGKKTLQAKIVEKRAQAKDASAEAKHFN 80 
73544405    1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFMMGKKTLQAKIVEKRAQAKDASAEAKHFN 80 
146090844   1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFIMGKKTLQAKIVEKRAQAKDASPEAKRFN 80 
146091271   1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFIMGKKTLQAKIVEKRAQAKDASPEAKRFN 80 
154339904   1 MPSITIAKREYEEHLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFVMGKKTLQAKIVEKHAQAKNASPGAKHFS 80 
154339906   1 MPSITIAKREYEEHLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFVMGKKTLQAKIVEKYAQAKNASPGAKHFS 80 
71754749   81 QVCTDKQLLCGNTSMIFTNSEVSDITSVLDSHRVQAPARVGAIAPCDVIVPAGNTGMEPKATAFFQALNIATKISKGTVE 160
71668472   81 NTCIEKKLLCGNTALIFTNEEIPVITAVLDKHRVQAPARVGAIAPCDVIVPAGNTGMEPKATSFFQALNIATKIAKGTVE 160
71668474   81 NTCIEKKLLCGNTALIFTNEEIPVITAVLDKHRVQAPARVGAIAPCDVIVPAGNTGMEPKATSFFQALNIATKIAKGTVE 160
71754751   81 QVCTDKQLLCGNTSMIFTNSEVSDITSVLDSHRVQAPARVGAIAPCDVIVPAGNTGMEPKATAFFQALNIATKISKGTVE 160
73544403   81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVIVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
73544405   81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVIVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
146090844  81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
146091271  81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
154339904  81 EQCEEHNLLSGNTGLIFTNDNVQEIKAVLDSHRVKAPARVGAIAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
154339906  81 EQCEEHNLLSGNTGLIFTNDNVQEIKAVLDSHRVKAPARVGAIAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
71754749  161 IVSDKKVLSTGDKVDNSTATLLQKLDISPFYYQVEVQSVWDRGVLFTREDLSVTDAVVEKYLLEGISNISAMSLGAGIPT 240
71668472  161 IVSDKKVLSVGDRVDNSTATLLQKLDISPFYYQVEVQSVWDRGMLFLREDLSITDDVVEKYLLEGISNVAALSLGAGIPT 240
71668474  161 IVSDKKVLSAGDRVDNSTATLLQKLDISPFYYQVEVQSVWDRGMLFLREDLSITDDVVEKYLLEGISNVAALSLGAGIPT 240
71754751  161 IVSDKKVLSTGDKVDNSTATLLQKLDISPFYYQVEVQSVWDRGVLFTREDLSVTDAVVEKYLLEGISNISAMSLGAGIPT 240
73544403  161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMDGLSNVAAMALGAGIPT 240
73544405  161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMDGLSNVAAMALGAGIPT 240
146090844 161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMEGLSNVAAMALGAGIPT 240
146091271 161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMEGLSNVAAMALGAGIPT 240
154339904 161 IVTEKKVLSTGDKVDNSTATLLQKLNISPFYYQVDVLSVWDRGVLFTREDLGMTEDIVEKMLMEGLSNVAAISLGAGIPT 240
154339906 161 IVTEKKVLSTGDKVDNSTATLLQKLNISPFYYQVDVLSVWDRGVLFTREDLGMTEDIVEKMLMEGLSNVAAISLGAGIPT 240
71754749  241 AATLPHMIVDAFKTLLGASVATNYEFEEYDGKNLRTAALEGKLGGGEAAAPAAAAAAAApAAAPAAAAAEEEEDDDDFGM 320
71668472  241 AATLPHMIMDAFKTLLGASVATEYEFDEFDGKNLRKAALEGNLGGGVADAAAAADTGAA-AAPAAAAEPEEEDDDDDFGM 319
71668474  241 AATLPHMIMDAFKTLLGASVATEYEFDEFDGKNLRKAALEGNLGGGAADAAAATDTGAA-AAPAAAAEPEEEDDDDDFGM 319
71754751  241 AATLPHMIVDAFKTLLGASVATNYEFEEYDGKNLRTAALEGKLGGGEAAAPAAAAAAAApAAAPAAAAAEEEEDDDDFGM 320
73544403  241 PSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSCSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
73544405  241 PSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSCSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
146090844 241 SSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSGSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
146091271 241 SSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSGSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
154339904 241 SATIGPMLVDAFKNLLAVSVATSYVFEEHNGKELREAALSGSLVGAGSAAVESAAAAPA-ASSAAAKVESEESEEDDFGM 319
154339906 241 SATIGPMLVDAFKNLLAVSVATSYVFEEHNGKELREAALSGSLVGAGSAAVESAAAAPA-ASSAAAKVESEESEEDDFGM 319
71754749  321 GALF 324
71668472  320 GALF 323
71668474  320 GALF 323
71754751  321 GALF 324
73544403  320 GGLF 323
73544405  320 GGLF 323
146090844 320 GGLF 323
146091271 320 GGLF 323
154339904 320 GALF 323
154339906 320 GALF 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap