Conserved Protein Domain Family
PTZ00239

?
PTZ00239: PTZ00239 
serine/threonine protein phosphatase 2A; Provisional
Statistics
?
PSSM-Id: 173488
View PSSM: PTZ00239
Aligned: 11 rows
Threshold Bit Score: 619.524
Threshold Setting Gi: 118354944
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118354944   3 ADVDQWLYTLkVDKEILTERDLRLLCEKVKEILIEESNVQPVSAPVTVCGDIHGQFYDLLELFQKGGEIPTSNYIFIGDF 82 
145474651   1 MDIDRHIATL-LNGGCLPERDLKLICDRAKEIFLEESNVQPVRAPVNVCGDIHGQFYDLQALMKEGGDISSANYIFIGDF 79 
145504911   1 MDIDRHIATL-LSGGCLPERDLKLICDRAKEIFLEESNVQPVRAPVNVCGDIHGQFYDLQALMKEGGDIPSSNYIFIGDF 79 
145512165   1 MDIDRHIASL-LSGGCLPERDLKLICERAKEIFLEESNVQPVKAPVNVCGDIHGQFYDLQALIKEGGDIPEHNYIFIGDF 79 
145490857   1 MDIDRHISQL-LRGGCLTERDLKLVCERAKEIFLEESNVQPVRAPVNVCGDIHGQFYDLQALMKEGGDISDHNYIFIGDF 79 
145516134   1 MDIDKYLETL-RNARCLTERDVRLVCEHAKEIFIEESNVHQVKAPVIICGDIHGQFFDLLELFNKGGQIPNANYIFIGDF 79 
145521735   1 MDIDRHIASL-LSGGCLPERDLKLICERAKEIFLEESNVQPVKAPVNVCGDIHGQFYDLQALIKEGGDIPEHNYIFIGDF 79 
145522860   1 MDIDRHISSL-LTGGCLPERDLKLVCERAKEIFLEESNVQPVRAPVNVCGDIHGQFYDLQALIKEGGDIPEHNYIFIGDF 79 
145524477   1 MDIDKYLETL-KNGRCLTERDVRLVCEHAKEIFIEESNVHQVKAPVIICGDIHGQFFDLLELFNKGGQIPNANYIFIGDF 79 
124088122   1 MDIDRHIATL-LNGGCLPERDLKLICDRAKEIFLEESNVQPVRAPVNVCGDIHGQFYDLQALMKEGGDISSANYIFIGDF 79 
118394889   2 KNIDDYLQTL-KEGKCLPERDLRLICEKAKEILIEESNVQPVRSPVIICGDIHGQFYDLLELFRVGDEIPNSNYIFIGDF 80 
118354944  83 VDRGHNSVETIEYLLCLKLKYPGNITLLRGNHESRQITSAYGFFDEISRKYGNSNPWKIFTDLFDHLALAAIIDGTVLCI 162
145474651  80 VDRGYNSVETMEYLLCLKVKYPGKIMLLRGNHESRQCTQVYGFYEELLRKYGNCSPWRLFMDVFDCLPLAALIEGQILCV 159
145504911  80 VDRGYNSVETMEYLLCLKVKYPGNIMLLRGNHESRQCTQVYGFYEELLRKYGNSSPWRLFMEVFDCLPLGALIEGQILCV 159
145512165  80 VDRGYNSVETMEYLLCLKVKYPGNIVLLRGNHESRQCTQVYGFYEELLRKYGNSSPWRLFMEVFDCLPLAALIEGQILCV 159
145490857  80 VDRGYNSVETMEYLLCLKVKYPGNIVLLRGNHESRQCTQVYGFYEEILRKYGNSCPWRLFMDVFDCLPLAALIEGQILCV 159
145516134  80 VDRGYNSVETFEYLLCLKLKYPDNITLLRGNHESRQITQVYGFYDEIVRKYGNANPWRYFTDVFDYLPLGALVDGKVLCV 159
145521735  80 VDRGYNSVETMEYLLCLKVKYPGNIVLLRGNHESRQCTQVYGFYEELLRKYGNSSPWRLFMEVFDCLPLAALIEGQILCV 159
145522860  80 VDRGYNSVETMEYLLCLKVKYPGNIVLLRGNHESRQCTQVYGFYEEILRKYGNSSPWRLFMDVFDCLPLAALIEGQILCV 159
145524477  80 VDRGYNSVETFEYLLCLKLKYPDNITLLRGNHESRQITQVYGFYDEIVRKYGNANPWRYFTDVFDYLPLGALVDGKVLCV 159
124088122  80 VDRGYNSVETMEYLLCLKVKYPGKIMLLRGNHESRQCTQVYGFYEELLRKYGNCSPWRLFMDVFDCLPLAALIEGQILCV 159
118394889  81 VDRGYNSVETLEYLICLKIKYPQHITLLRGNHESRQITQVYGFHDEVVRKYGNSNPWKYCTDVFDYLPLGAIVDGKVLCI 160
118354944 163 HGGLSPDIKTLDQIRTINRKIEIPHDGPFCDLMWSDPDDLESWQLSPRGAGWIFGWKPTEEFCRINGLQLICRAHQLAQE 242
145474651 160 HGGLSPDMRTIDQIRTIDRKIEIPHEGPFCDLMWSDPEEVEYWAVNSRGAGYLFGAKVTKEFCRLNDLTLICRAHQLVME 239
145504911 160 HGGLSPDMRTIDQIRTIDRKIEIPHEGPFCDLMWSDPEEVEYWAVNSRGAGYLFGAKVTKEFCRLNDLTLICRAHQLVME 239
145512165 160 HGGLSPDMRTIDQIRTIDRKIEIPHEGPFCDLMWSDPEEVEYWAVNSRGAGYLFGAKVTKEFCRLNDLTLICRAHQLVME 239
145490857 160 HGGLSPDMRTVDQIRTIDRKVEIPHEGPFCDLMWSDPEEVDYWALNSRGAGYLFGAKVTKEFCRLNDLSLICRAHQLVME 239
145516134 160 HGGLSPELRTIDQIRTIDRKTEIPHEGPFCDLMWSDPEEVDTWALNTRGAGWIFGKKVTHDFNHINGLELIARAHQLVQD 239
145521735 160 HGGLSPDMRTIDQIRTIDRKIEIPHEGPFCDLMWSDPEEVEYWAVNSRGAGYLFGAKVTKEFCRLNDLTLICRAHQLVME 239
145522860 160 HGGLSPDMRTVDQIRTIDRKVEIPHEGPFCDLMWSDPEEVEYWAVNSRGAGYLFGAQVTKEFCRLNDLSLICRAHQLVME 239
145524477 160 HGGLSPELRTIDQIRTIDRKTEIPHEGPFCDLMWSDPEEVDTWALNTRGAGWIFGKKVTHDFNHINGLELIARAHQLVQD 239
124088122 160 HGGLSPDMRTIDQIRTIDRKIEIPHEGPFCDLMWSDPEEVEYWAVNSRGAGYLFGAKVTKEFCRLNDLTLICRAHQLVME 239
118394889 161 HGGLSPEIKTIDQIRIIERKVEIPHDGPFCDLMWSDPEDISNWAINSRGAGWLFGAQVTKEFNHLNGLQLIARAHQLVEQ 240
118354944 243 GYKYWFTKQNLVTVWSAPNYCYRMGNAASILSFDENMQRQFTFFNAVPESSRATSYKQVLPYFL 306
145474651 240 GYKYWFPDQNLVTVWSAPNYCYRCGNVASILCLDENLNQTWKTFKEVPESAKSVNPKSVLPYFL 303
145504911 240 GYKYWFPDQNLVTVWSAPNYCYRCGNIASILCLDENLNQTWKTFKEVPESAKSVNPKSVLPYFL 303
145512165 240 GYKYWFPDQNLVTVWSAPNYCYRCGNVASILCLDEQLQQSWKTFKEVPESAKSINPKNVLPYFL 303
145490857 240 GYKYWFPDQNLVTVWSAPNYCYRCGNIASILSLDSSLQSNWKTFREVPESSKSINPKNVLPYFL 303
145516134 240 GYQYWFEEQ-LVTVWSAPNYCYRCGNAASMLSLDENLKRDFVMFKEVPESAASQPPKNVLPYFL 302
145521735 240 GYKYWFPDQNLVTVWSAPNYCYRCGNIASILCLDDQLQQTWKTFKEVPESAKSTNPKNVLPYFL 303
145522860 240 GYKYWFPDQNLVTVWSAPNYCYRCGNIASILCLDNQLQSNWKTFREVPESGKSINPKNVLPYFL 303
145524477 240 GYQYWFEEQ-LVTVWSAPNYCYRCGNAASMLSLDENLKRDFVMFKEVPESANSQPPKNVLPYFL 302
124088122 240 GYKYWFPDQNLVTVWSAPNYCYRCGNVASILCLDENLNQTWKTFKEVPESAKSVNPKSVLPYFL 303
118394889 241 GYQYWFPDKNLVTVWSAPNYCYRCGNIAAILKLDENLEQKFETFNAVTDASKQINPKSLLPYFL 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap