Conserved Protein Domain Family
PTZ00238

?
PTZ00238: PTZ00238 
expression site-associated gene (ESAG); Provisional
Statistics
?
PSSM-Id: 140265
View PSSM: PTZ00238
Aligned: 13 rows
Threshold Bit Score: 587.08
Threshold Setting Gi: 72387487
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72387692    1 MKVKIIEWLVFLSFVIYTEGAEDEGRCRLVDDHSF-KNLHESVCYLSCLSDALNKLYTNGERKLLVNEEVYANASRILDD 79 
72386453    1 MKVVAVELIILYFFVICIGGEEEGGKCRLVADVGGfAHINVSLCYLHCLSNALNKLYTDGEQRLFVNEEVYANASRILDD 80 
71743860    1 MKVIVERCLAFSLFVICIGGAEEEGPCTLVDDYYK-KNLKETLCYLRCLSNALNKLYTDGERKMLVNEEVYANASRILDD 79 
71746438    1 MRVVILEWTILILLIVGAYGDND---HALVADYEGdAPLSETVCYLRCLSDALNKLYTDGEKKLLVNEEVYANVSRILDS 77 
74026410    7 KKTRIGVWLSLSFLLISFSLARD---CTLVDDYYG-KNVPESVCYLSCLSNALNKLYNDGEEKLFVNEEVYADASRILDD 82 
72387487    1 MKVEIVELAILLSFIICVDGENVEHNCKTVDDYYF-RNINESVCYLSCLSNALNKLYSDGEKRLFVNEEAYANASRILDD 79 
72386843    1 MKIKIVGLVVFFFVTF---GVAEESYCTSIDDDKG-TNLNQSVCYLKCLSDALNKLYTDGERKLFLNEEVYANASRMLDD 76 
72389672    1 MKITIVELVILLFFAVNIDG--EGGACMLLADVENdVSLDESVCYLSCLSSALSKLYTDGERKMFVNEEVYANASRILDD 78 
115504819   1 MKVTIAELVVLLFSVICIDGKEENG-CTLITDYHGdAPLSESVCYLSCLSDALNKLYADGENKLFVNEEVYANAFRILDD 79 
115504835   1 MKVAVFQWLIWAFLMACACGKDD---YTLVTDHEGdAPLNESVCYLSCLSDALNNLYSDSEKRLFVNEEVYANASRILDD 77 
115504843   1 MKVVIVELVISLLLVVYVCGAEEDGTCRLVADSGGhSHLNESVCYLSCLSSALNKLYTDGERKMLVNEEVYANASRILDD 80 
115504779   1 MKVTIAELVVLLFSVICIDGKEDNG-CTLITDYHGdAPLSESVCYLSCLSDALNKLYSEGERRLFVNEEVYANAFRILDD 79 
115504771   1 MKVTIAELVVLLFSVICIDGKEDNG-CTLITDYHGdAPLSESVCYLSCLSNALNKLYSEGERRLFVNEEVYANAFRILDD 79 
72387692   80 MEGRAGESVKYLSVISDAMGGKHDKLEKLISYGNTMGDLVAKVGGLFADVNESVRVVRELLPTALMEANRYYTASAEITR 159
72386453   81 MEGKTGESTTYLSVFSSSMGEQNDKLEKLISYGNEMGDLVAKVGGLFAEVNESVREVRNELPNTLIKANKYYTAIAVITK 160
71743860   80 MEGKTGESTKYLSVVSSAMGDQRKKMEKLISYGNEMGDLVAKVGGLFSEVNESVRAVRKYLPDALTTANKYYASIAEITR 159
71746438   78 MEAKTGESVKYLSVISGAMVGESEKLEKLISYGNTMGDLVAKVGGLFAEVNESVRTVRKEIPDALIKANKYYTSIAEIVR 157
74026410   83 MEGETAECVKYLSVISGVMEGKHDKLEKLISYGNEMGDLVAKVGGLFADVNESVRAMREVLPSTLITANKYYTAISEIVR 162
72387487   80 MEGKTGESTKYLSVISSVMEGEHDKLEKLISYGNQMGDLAAKAGGLFVEVNESVRAVRKEIRDALIQANKYYTAVAEIAG 159
72386843   77 MEGKTGESVIYLSVISSVMVEENDKLENLISYGNAMGDLVAKAGGLFAEVNESVRAVRNAIPGALITSNKYYTAIAEIAR 156
72389672   79 MEWKSGESATYLSVISGVMEGKHDKLEKLISYGSAMGDLVAKVGGLFVGVNESVRAVRNAVPDALITANKYYTAAAEVER 158
115504819  80 MEGRTGESVRYLSIISGVMEGKHDKLKKLISYGNAMGDLVAKAGGLFAEVNESVRAVRKEIPGALIKVNKYYTAIAVITR 159
115504835  78 MEGKSGESTKYLSVISSVISKQNDKLEKLISYGNEMGDLVANVGGLFSEVNESVRAVREVLPSALIRANKYYTAIAEIVR 157
115504843  81 MEGKTGESTEYLSVISGVMESEHDKLEKLITYGNEMGDFVAKAGGLFAEVNESVREVRKVLPSALMEANKYYAAIAEITR 160
115504779  80 MEGRAGESVRYLSIISVAMVEENNRLEKLISHGNAMGDLVAKAGGLFAEVNESVRAVRKEIPGALIKVNKYYTAIAEITR 159
115504771  80 MEGRAGESVRYLSIISVAMVKENNRLEKLISHGNAMGDLVAKAGGLFAEVNESVRAVRKEIPGALIKVNKYYTAIAEITR 159
72387692  160 TVW--DDVKAVEGSDeeAAKCKGENI-GVTEFPTTCGNHTCPLRDNVSDDTLQKYKDGCLEINVLktPGYVSECLNRPRN 236
72386453  161 TVW--NDVKAVGLDSd-MAKCSRQEFsAVENFEASCGDQTCPLENSVTESSLQKYKDGCLTITIL--NGSVSECLNRLRD 235
71743860  160 TAW--DDVKAVEAGG--TAKCEERTFqRVKGLLTPCADQTCPLAKTVNESTLKTYKDGCLAVTVQ--NGSVRECFNLPRD 233
71746438  158 TVW--DDLKAIPTSI--DPKCENGEFdGVKEFEVKCGDSSCPLRNGVSEDALKHYKRGRIEVNVL--NGSVSRCLNLQRK 231
74026410  163 TVW--DDVKAVKSDDeeVLQCRNGKIiSTGEFSVKCSAHTCPLGVNVTESTLKKYKDGCLEINVMteSGQVSKCFNLPRN 240
72387487  160 TVWafDGQKVVEGDH----KCDLEASkKTVEFQSKCSAHTCPLRNGVNKSTLQQYKNGCLEISVMh-SHIVDFCHQSPRN 234
72386843  157 TVW--DDVKAVSNDE--GPECKKGALkGVRGFPVVCVDQTCPLLTGVNEITLQKYRGGCLQIDVLtgSGSVSKCLNLPRD 232
72389672  159 TVW--DDVKGMEAPRm-SAECSDPVFtNVAGYKVICPDYVCPFNHGVTAAAFRKYKNECLEITVY--YPNKCRAQGLPRG 233
115504819 160 TVW--DDVEALERDS--DPNCHGEKIkNVGEFQVTCGEHFCPLKEGVNESTLQKYKDGCLEINVQdkSGQISECLNLPRN 235
115504835 158 TVW--DDVNRPLKQD--EAKCGNQNFgSVGEPKNECVYRTCPLGDGVSEDTLQHYKKGGIEINVQ--TGSVSECFNRPRD 231
115504843 161 TLW--DDAKAVKSDDeeVLQCRNGKIiSTGEFAVKCSAHTCPLEANVTESNLKMYKDGCLEINVM--GGSVSKCFNLPRN 236
115504779 160 TVW--DDVKAVESGK---HECKDQEFrGVKEFDVTCGDNACLLAHGVSEGALKHYKNGLLEINVM--SGSVSKCLNLPRN 232
115504771 160 TVW--DDVKAVESGK---HECKDQEFrGVKEFDVTCGDNACLLAHGVSEGALKHYKNGLLEINVMtkSGGVSKCLNLPRN 234
72387692  237 KLYMDGAVNNLSDTIKWRgesRDGAIFFQLTVQVQNVFGPLIGPFSAGQPPPVLLEVMSNITSLHSHFNKVHNNFTSLLF 316
72386453  236 NLYRSGAVQSSRKILEWRgedRHGAFYFQLTLEIQQIFSTLITPFAAGKPPFALLDMMANITSLNSHFNWVHGNFTSLLL 315
71743860  234 NLYRSGAVKNSNDALEWKe-vRDRGASFQLKVKVQEIFGPLITPFAAGQPPSMLLGMVSNITSLHSQFNKVHNNFTSLLF 312
71746438  232 NLYKNGAEKHSSEVLKWP---QDDATFFQLKLEVQSMFGPLIVSFAAGRTTSALLEMVENITSLRSRFKEIHSDFTSLLL 308
74026410  241 NLYISGARINSSGVLEWS---QNDSAFFRLIVKVQDIFAPLIAPFSAGKPPSVLLTKMTNITSLYSHFNKVHNNFTSLLR 317
72387487  235 VLYVSGAVKDSGNALKWK-----PGHAFFLTIEVKGIFSSLIASFTAGHPPPVLLAMVSNMTLLYSLFSETYSNFTSLLL 309
72386843  233 NLYKGGAVKNSTGLINWR---ENGPAFFQLQIYVEEIFDPLIEPFTSGKAPPELLDMMANITLLQSYFNDIHRNFTSLQF 309
72389672  234 KLYGNGIVKNLTTLLEWR----DDHSYFQLTLKIRQMLDPLIVPFASGFPPSVLVGTLSNITSLYSHFNEVYSNFTSLLL 309
115504819 236 SLYKNGAVKYSSDGTNWY---GNGNTYFQLKLHVHSMLSPLTIPLGAGQPPSAPLDMMASITSLYSRFNEIHKNFTSLLL 312
115504835 232 NLYRNGAEKHSSDVLKWL---EGETTRLQLTVEVQKIFGPLIVPFAAGQSPSALRAMMSNITFLYSHFKEVHSNFTLMLH 308
115504843 237 NLYISGARINSSGVLEWF---ENGASFFRLIVKVQDIFAPLIAPFAAGKPPSVLLTKMTNITSLYSQFNKVHNNFTSLLL 313
115504779 233 NLYLNGAINSSHGLLKWR---QHSAEMFQLELRVKNIFNPLVASFAAGQSSSVLAEMMANITSLYSRFNEVHRSFTSLLV 309
115504771 235 NLYKSGAVNNSNKVLDWRd-dADTVTHFLLKLKIRDIFSTLIAPFAAGQPPSALLDMMANITSLYSRFNEVHRSFTSLLF 313
72387692  317 DIDVAGNVT--TANSSI 331
72386453  316 DIGVAGNVS--NTNSTI 330
71743860  313 DIDVAGNVT--TANSSI 327
71746438  309 NPNSTDNVN--STDSTI 323
74026410  318 DTNITVNADntNTNSTI 334
72387487  310 GTSITDNLN--STDSTT 324
72386843  310 STNNIDNMK--STNFTI 324
72389672  310 GTNTPENVN--RTNFPI 324
115504819 313 NTNFTGIVN--SSNSDF 327
115504835 309 DTNITDNLN--STHSTI 323
115504843 314 ENNITGNVN--KTRSSF 328
115504779 310 NPNLTDTGD--GIDSIF 324
115504771 314 DTNSIDNVK--STNSTI 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap