Conserved Protein Domain Family
PTZ00236

?
PTZ00236: PTZ00236 
mitochondrial import inner membrane translocase subunit tim17; Provisional
Statistics
?
PSSM-Id: 173487
View PSSM: PTZ00236
Aligned: 17 rows
Threshold Bit Score: 222.996
Threshold Setting Gi: 145548515
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66358830   23 FIMSDFTREPFPGRVFEDLGGAFSMGCIGGFITSFFKGVKYSStKREMFSSGMLFARKAAPSLGTSFAIWGGTFSCFDCL 102
66806813    1 ------MEAPCPDKIWQDAGGAFAIGYVLMGVVNIGLGFKRSP-PNKRVLYTFALLRKKSPKFGGNFAIWGSLFSGFDCT 73 
145484089   1 ---MAMREQPCPYRIIDDFGGAFSMGCFAGCIFYFLKGMSFAP-KKERFFGGIQLLKRRAPILGGSFALWGGLFSITDCT 76 
145508057   1 ---MAMREQPCPYRIIDDFGGAFSMGCFAGCIFYFLKGMSFAP-KKERFFGGIQLLKRRAPILGGSFALWGGLFSITDCT 76 
145548515   1 ---MAMREQPCPYRIIDDFGGAFSMGCFAGCIFYFLKGMSFAP-KEGEIF-------RRAPILGGSFALWGGLFSITDCT 69 
145520295  26 RIKMAMREQPCPYRIIDDFGGAFSMGCFAGCIFYFLKGMSFAP-KKERFFGGIQLLKRRAPILGGSFALWGGLFSITDCT 104
156086670   1 MEGRDVSREPCPDRIVEDMGGAFGMGCVGGFLWHFVKGARNAP-RGIIMQNAFYNARSRAPVLGGNFAVWGGTFSTFDCT 79 
167538379   6 EEEQSFQREPCPYRILDDCGAAFAMGAIGGTIWHGVRGYRNAP-TGLKYREMISAVKLRAPTVGGNFAIWGALFSTFDCS 84 
209882723   4 FMSRDLSRDPCPDRIIEDLGGAFGMGCVGGFLWNFLHGARNAP-RGEIFSSGLSAGSLRAPIIGSSFAVWGGTFSCFDCS 82 
237830293   2 PPRHDLTREPCPGRILEDLGGAFGMGALGGFLWHFAKGWRNSP-KYEKFAGGMLSGSMKSPLVGSSFAVWGGLYATFDCS 80 
66358830  103 FAKLR-GKEDHWNAIFSGTATGGLLAIRGGLKTSLKSAMVGGILLTIIESVSIGINRKTIQTPRQQFKEYQRFVQMSEER 181
66806813   74 LSYIR-KTEDTVNPIAAGALTGGILAARSGWKHSVQAAAFGGIFIGIIEAFQHMMQKRMQAQQEEMTQQHLEERKRYEEE 152
145484089  77 LMHLR-NQQDFINPIVAGAFTGGFLAIRAGTRIAVRNAIFGGIILGFIQLAEVGMLKMQMREEMKRMQQQQQQQMAEMQE 155
145508057  77 LMHLR-NQQDFINPIVAGAFTGGFLAIRAGTRIAVRNAIFGGIILGFIQLAEVGMLKLQMREEMRRMQQQQQQQMQEMQE 155
145548515  70 LMHLR-NQQDFINPIVAGAFTGGFLAIRAGTRIAVRNAIFGGIILGFIQLAEIGMLKIQMREEMKRMQQQQQQQMQEMQE 148
145520295 105 LMHLR-NQQDFINPIVAGAFTGGFLAIRAGTRIAVRNAIFGGIILGFIQLAEVGMLKMQMREEMKRMQQQQQQQMAEMQE 183
156086670  80 FQYLR-GKEDHWNAIASGFATGGTLALRGGMGHAARNAVIGGLLLSIIEVVSVVVNRRMTPTPRQQFERQMEYERQLK-- 156
167538379  85 FVALR-GKEDPWNAISSGFFTSGLLSIRYGPKTAFKAALGGAFILSLIEGVAIAINRFQADAAKPKLPELAEMPADPLGP 163
209882723  83 ITALR-QREDHWNAIFAGAATGGLLALRGGWRSATRSAFVGGVLLAIIEIVSIGLSRRTMQTPRQQFRDYETGVKRLKEK 161
237830293  81 LIYLRgGKEDSWNPVLSGALTGGVLSMRSGWRSCMKNAAIGGVLLGIIEVVQLAFQRSTGEGPTPRQQYRQYLEMEQAER 160
66358830  182 DKTSKI 187
66806813  153 RKQREG 158
145484089 156 MMEMQN 161
145508057 156 MMAMQG 161
145548515 149 MMAMQV 154
145520295 184 MMEMQT 189
156086670     ------    
167538379 164 PPSANA 169
209882723 162 DKNQSN 167
237830293 161 RAAEQA 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap