Conserved Protein Domain Family
PTZ00229

?
PTZ00229: PTZ00229 
variable surface protein Vir30; Provisional
Statistics
?
PSSM-Id: 140256
View PSSM: PTZ00229
Aligned: 3 rows
Threshold Bit Score: 468.251
Threshold Setting Gi: 156092580
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156092555  20 LFFHLIKFNKAKCrydffdNISNYMKDGKSIEDTVRSVDASKYCDSFSSATASqlGDKENAKYICEIFTKLCNHFPNCKK 99 
156092580   1 MIFHIHIMIKAKW------TAINYIESSNKLESNTTELDAQDNCTTFSNAYTS--SNFDTGKKVCELFIKLYNSLSNVEN 72 
156092559   1 -------MNIAQWiykffkDIDKYIAKAKDVESIDISDGLPSACTSFSRNWESklKINGTAENICVKCIKLYDSLDYINK 73 
156092555 100 -QEQNTSykQNCGLLNYWLNMKLNDDKINGKTCVLEIENTIQSQCSDIFEFNFDSlNFLYDIKKEELHKMNILYSLYQNY 178
156092580  73 gNKPDDT--KDWHFLNYWLNINISKRKLNKSTCATKFSDGLSHHCTYTFSYEFPP-EFIYNIREEELIKMNLLYSLYENY 149
156092559  74 tLPTDTNykKDCEFLNVWLNLKLYNNVINETDCVSMFYDELEAHCAGDCLGSLSDfQ-MYNIKNDDLDKMKILYNLHYKR 152
156092555 179 SKLKNIIENKSGPEKTSLLPHSTACCADYNKAKYICSDDNNKitFCKKLVTFESKYDELYNTFKGKKSEFSDDLIKLSEC 258
156092580 150 KKLDNILNGQKPVNAGSLLGPSAKCCSDYAEANYLCNDKNNE--FCTQLKKFKEKYDGLYNTEIEGKPEYTNNFIKLSQC 227
156092559 153 SEIRDLIDTASNKDAKLLLEPSTLCFNEYRIAASKCNNKDSK--FCKLLENFKNEYEKLYPVVETKSPEFLKNFKRLSGD 230
156092555 259 TDNKiITTAVTGTVVGLIPLFGVLYKFTPMGQLLKSKIGILNNDISNNDEEYTKISLMEQESDHISSRQGTYNIKYQTL 337
156092580 228 DNNT-MSKALIGTTVGLVPLLVGLYKFTPLRQLMNFKKGKLAEQYRNNDDEMRDIMLMDQGSEHISSQQGRYNIKYHSV 305
156092559 231 ENNKiISTAVTGSIVGLIPLVGILYKYTPMGQLLKPNKGKVMDGQIYNGKDMRNISLMDQENEPSTFQQGTYNIKYQSA 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap