Conserved Protein Domain Family
PTZ00227

?
PTZ00227: PTZ00227 
variable surface protein Vir14; Provisional
Statistics
?
PSSM-Id: 140254
View PSSM: PTZ00227
Aligned: 4 rows
Threshold Bit Score: 689.349
Threshold Setting Gi: 156093113
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156092968   1 MFDIDSGG-NQAEADDETISESTIQGDRIIFHHLPAYKFEQELKEDANGNIYNTYFNSLSRTMARFQWSQDLYNKLSRNI 79 
156093113   1 MFDLEGGG-TQVEADDETISESTIQGQRIIFEHLPAYIFEQKLKEDATDNNFSGYYNVVKHISERYGWGNDLFKKLSRNI 79 
156092808   1 MFSLDSDStSQVEADVDSISESTIKGERVIFKYLPAYLFEEKLKEHASSNEYSKYYNGLYNISKRYPWLEDIFKKLSRNI 80 
156092522   1 MFNLDSDGaSQVEADVDSISESTIKGERVIFKDLPAYLFEEKLKGDASTNEYSSYYNGLNNFSKRYPWLDDIFKKLSRNI 80 
156092968  80 KLVHDRFVEGDEFNKKRCYDLNFWLYNEVFNNLKSTSENDTKFFKDISTRLQEVWKNVVDANYKGQPFQCYPDKALLLNM 159
156093113  80 SLVHDSYIEGDEFNRKRCYDLNYWLYDNVYKNLESSNTNDTDYFKDISTKLQGVWKNIVDNEFKDRPYQCYPDKELLLNM 159
156092808  81 TLVQRSYVEGDDFNKKRCYDLNYWLYNEVYKNLQSS-EKDLIYFNEITTDLKRAWKKIVDDVFRNDHYKCYPDEKLLVNM 159
156092522  81 ALVQESYVEGDDFNKKRCYDLNYWLYNEVYNKLQTS-EKDLVHFNEITTNLKAVWKKIVDDTFGGGDYKCYPDEKLLVNM 159
156092968 160 GYLQEVKDLFDFFQDYNEMKKEIIADTYKSCRRYLDYLKQRIPVYYTWRDSCKVDEFACKRYIDDYMKYRPASIVPDLN- 238
156093113 160 GYLQEIKDLFDFYEDYNEMKKEIIADTSGSCRRYVEYLKQRIPVYYTWRDSCKVPEYTCKRYIDDYMKYRPASIVPDLS- 238
156092808 160 GFLQEIKDLFDFYEDFNEMKKEIVDDTYNSCFKYVDYLKQRIPVYYAWRDSCKVDDFACKRYIDDYMKYRPAGIVSELSy 239
156092522 160 GFLQEIKDLFDFYEDFNEMKKEIIYDTYNSCFKYSDYLRQRIPVYYAWRDSCQVDDFACKRYIDDYMKYRPASIVPELSy 239
156092968 239 PLIVLWYPYTPCYQSVYDLFVKAKEQPKRNDGIYKKKMEKLERLNPGGNLLLTDMGDGLRGSEFFIPGDHDDYWLRLKWD 318
156093113 239 PWVVLTYPGNKCYATVYDIFVKAKEQPKRNDGIYKKKMEKLEKLNPGKSLLNISMGEGLRGSEFFIPGDHDDYWLRLKWD 318
156092808 240 ISVILTYPGNPCYSSVYDVFIDAKVQPKRNDDIYRRKMEKLAKENPRGNLLLTDMGDGLRESEFFIPGDHDVYWYRKGWG 319
156092522 240 LRVILTYPGNPCYSSVYELFIDAKTQPKRNDDIYRRKMEKLAKENPQGNLLSTNMGDGLRGSEFFIPGDHDDYWLRFKWD 319
156092968 319 ILLYITDDITPPLLGIVGVLLILWALYkftpigksvrrtraKVRKRIRPNINYDDIKLLYGSEESLNSSTDSYDYNNDY- 397
156093113 319 ILLYITDDITPPVLGIVGTLLIFWALY--------------KVRKRIRPNINYDDIKLLYGSEESLNSSTDSYDYNNDYd 384
156092808 320 IYNRITHNITLPMLGIAGVFLILYAFYkftplgkmfkhtraKVRRRIQPNINYDDIVLLYGSEESLAS------------ 387
156092522 320 IYFFFKEDLSPPLLSITGGFLILYALYkftplgklfkhtraKLRRRFRPNLNYEDIVLLYGSDESLAS------------ 387
156092968 398 -DYDD---SNSNSSYNFSYSSSLDY 418
156093113 385 nDYDNddySDSNSSYNLSYASTLDY 409
156092808 388 --------SSVDSSYNLSYASSLS- 403
156092522 388 --------SSDDSSYNLSYASSTDS 404
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap