Conserved Protein Domain Family
PTZ00225

?
PTZ00225: PTZ00225 
60S ribosomal protein L10a; Provisional
Statistics
?
PSSM-Id: 140252
View PSSM: PTZ00225
Aligned: 10 rows
Threshold Bit Score: 368.605
Threshold Setting Gi: 71748990
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71660333    1 MSKIPPAQLSEAIQAVLTNRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNNVP 80 
71420692    1 MSKIPPAQLSEAIQAVLTNRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNNVP 80 
71748990    1 MSKIPPALLSEAIQNVLKDRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNDVP 80 
74024938    1 MSKIPPALLSEAIQNVLKDRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNDVP 80 
146103761   1 MSKIAPQTLVEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80 
146083933   1 MSKIAPQTLVEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80 
154335511   1 MSKISPQTLSEAIQAVLKVDKERKFKESIDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80 
157867831   1 MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80 
157877260   1 MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80 
154346164   1 MSKISPQALSEAIQAVLKVDKERKFKESIDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80 
71660333   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAMSESLPEKVLEIQSTVKFQLKKVL 160
71420692   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAMSESLPEKVLEIQSTVKFQLKKVL 160
71748990   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAQNESLPDKVLELQSTVKFQLKKVL 160
74024938   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAQNESLPDKVLELQSTVKFQLKKVL 160
146103761  81 TMNQEDLKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTDKIVELRSTVKFQLKKVL 160
146083933  81 TMNQEDLKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTDKIVELRSTVKFQLKKVL 160
154335511  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTEKVVELRSTVKFQLKKVL 160
157867831  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLADKIVELRSTVKFQLKKVL 160
157877260  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLADKIVELRSTVKFQLKKVL 160
154346164  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTEKVVELRSTVKFQLKKVL 160
71660333  161 CLGTCVGHVEMTEDQVRQNTVMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
71420692  161 CLGTCVGHVEMTEDQVRQNTVMAVNFLVSLLKENWQNLKSAYIKSTMGNRSAFT 214
71748990  161 CLGTCVGHVDMTEDQVRQNVVMAINFLVSLLKKNWQNLKSAYIKSTMGKSQRIY 214
74024938  161 CLGTCVGHVDMTEDQVRQNVVMAINFLVSLLKKNWQNLKSAYIKSTMGKSQRIY 214
146103761 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
146083933 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
154335511 161 CLGTCIGHIEMNEEQLRQNVMMAINFLVSLLKKNWQNLKSAYIKSTMGRPQRIY 214
157867831 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
157877260 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
154346164 161 CLGTCIGHIEMNEEQLRQNVMMAINFLVSLLKKNWQNLKSAYIKSTMGRPQRIY 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap