Conserved Protein Domain Family
PTZ00222

?
PTZ00222: PTZ00222 
60S ribosomal protein L7a; Provisional
Statistics
?
PSSM-Id: 140249
View PSSM: PTZ00222
Aligned: 10 rows
Threshold Bit Score: 438.363
Threshold Setting Gi: 71414791
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71659118    1 MPGKEVKKAAKPaaktaaktaakpaaksaakpaakpaakpaakpaakpaaktaakpakkpavkptvkpaAKAAAPYKKP- 79 
71414791    1 MPGKEVKKAAKPapktaakpaakpaakpaaktaakpvak----taakpvaktaakpakkptvkpavkpaAKAAAPYKKP- 75 
72392337    1 MAGKEVKKAVKPt--------------------------------------------------------KKAGVPYKKPe 24 
72392339    1 MAGKEVKKAVKPt--------------------------------------------------------KKAGVPYKKPe 24 
154332356   1 MPGKEAKRATQP---------------------------------------------------------VKAASPYKKP- 22 
154332358   1 MPGKEAKRATQP---------------------------------------------------------VKAASPYKKP- 22 
146077433  70 MPGKEVKKATQP---------------------------------------------------------AKAASPYKKP- 91 
146077437  85 MPGKEVKKATQP---------------------------------------------------------AKAASPYKKP- 106
157864492   1 MPGKEVKKVTQP---------------------------------------------------------AKAASPYKKP- 22 
157864494   1 MPGKEVKKVTQP---------------------------------------------------------AKAASPYKKP- 22 
71659118   80 ----------AAISPFVARPKNFGIGHDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALHQFTKVLDRSSRNELL 149
71414791   76 ----------AATSSFVARPKNFGIGHDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALHQFTKVLDRSSRNELL 145
72392337   25 vtqkkakasaAAPSPFVARPKDFGIGRDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRSSRNELL 104
72392339   25 vtqkkakasaAAPSPFVARPKDFGIGRDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRSSRNELL 104
154332356  23 ----------AAASRFTARPKNFGIGQDVPYSRDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRTSRNEVL 92 
154332358  23 ----------AAASRFTARPKNFGIGQDVPYSRDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRTSRNEVL 92 
146077433  92 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 161
146077437 107 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 176
157864492  23 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 92 
157864494  23 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 92 
71659118  150 KLVKKYPSETRRARRQRLFDVATEKKKNPE-AASKKAPLSVVTGLQEVTRTIEKKTARLVMIANNVDPIELVLWMPTLCR 228
71414791  146 KLVKKYPSETRRARRQRLFDVATEKKKNPE-AASKKAPLSVVTGLQEVTRTIEKKTARLVMIANNVDPIELVLWMPTLCR 224
72392337  105 KLVKKYAPETRKARRDRLTKVAEEKKKNPKgTVSTKAPLCVVSGLQEVTRTIEKKTARLVLIANNVDPIELVLWMPTLCR 184
72392339  105 KLVKKYAPETRKARRDRLTKVAEEKKKNPKgTVSTKAPLCVVSGLQEVTRTIEKKTARLVLIANNVDPIELVLWMPTLCR 184
154332356  93 RLIKKYAPETRKARRDRLHKAAEEKKKDPRkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
154332358  93 RLIKKYAPETRKARRDRLHKAAEEKKKDPRkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
146077433 162 KLIKKYAPETRKARRERLHKAAEEKKKDPKkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 241
146077437 177 KLIKKYAPETRKARRERLHKAAEEKKKDPKkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 256
157864492  93 KLIKKYAPETRKARRERLQKVAEEKKKDPKkTVSTKAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
157864494  93 KLIKKYAPETRKARRERLQKVAEEKKKDPKkTVSTKAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
71659118  229 ANKVPYAIVKDKARLGDAVGRKTATCVAITDVNAEDEAALKNLIRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 308
71414791  225 ANKVPYAIVKDKARLGDAVGQKTATCVAITDVNAEDEAALKNLIRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 304
72392337  185 ANKIPYAIVKDKARLGDAIGRKTATCVAFTDVNAEDQAALKNLTRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 264
72392339  185 ANKIPYAIVKDKARLGDAIGRKTATCVAFTDVNAEDQAALKNLTRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 264
154332356 173 ANNIPYAIVKDMARLGDAIGRKTATCVAITDVNAEEEAALKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
154332358 173 ANNIPYAIVKDMARLGDAIGRKTATCVAITDVNAEEEAALKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
146077433 242 ANKIPYAIVKDMARLGDAIGRKTATCVAITDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 321
146077437 257 ANKIPYAIVKDMARLGDAIGRKTATCVAITDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 336
157864492 173 ANKIPYAIVKDMARLGDAIGRKTATCVALTDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
157864494 173 ANKIPYAIVKDMARLGDAIGRKTATCVALTDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
71659118  309 RNAGKDAAAVM 319
71414791  305 RNAGKDAAAVM 315
72392337  265 RTAGNDAAAKA 275
72392339  265 RTAGNDAAAKA 275
154332356 253 RNAGVDAAAVV 263
154332358 253 RNAGVDAAAVV 263
146077433 322 RNAGVDAAAII 332
146077437 337 RNAGVDAAAII 347
157864492 253 RNAGVDAAAII 263
157864494 253 RNAGVDAAAII 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap