Conserved Protein Domain Family
PTZ00221

?
PTZ00221: PTZ00221 
cyclophilin; Provisional
Statistics
?
PSSM-Id: 140248
View PSSM: PTZ00221
Aligned: 10 rows
Threshold Bit Score: 393.851
Threshold Setting Gi: 72389923
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71418924   12 LRKEKVEHSNVRADTEDDVSPLNKRYQDVEERRLKEWENYQRSHRSTEEQQSSRAFLDISIGDVLAGRLVLELFEDTVPN 91 
71656129   12 LRKEKVEHSNVRADTEDDVSPLNKRYQDVEERRLKEWENYQRSHRSTEEQQSSRAFLDISIGDVLAGRLVLELFEDTVPN 91 
72389935   12 SRRKKGDSRLQRPENDEDSATLQSRYDDVEERRLKEWENYQRSHRMKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPR 91 
72389931    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35 
72389927    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35 
72389923    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35 
72389919    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35 
146093410   1 MPFRVLKPRRDAPQALLTPPSREQVYNNIEERRLKEWENYQKAHRFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPE 80 
154341371   1 MPLRALKARKDAPQVLPPMPSREQVYNDIEQRRLKEWENYQKSHRFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPE 80 
157872085   1 MPFRVLKPRRDAPQALPTPPSREQVYNNIEERRLKEWENYQKAHRFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPE 80 
71418924   92 TVLNFRSLITGSCGVDPVTGVRLDYLYTPVHRVDRARKLILLGELESLNVSSTGTPIQDEGYGKCHSERGLLTMVSDGPH 171
71656129   92 TVLNFRSLITGSCGVDPVTGVRLDYLYTPVHRVDRARKLILLGELESLNVSSTGTPIQDEGYGKCHSERGLLTMVSDGPH 171
72389935   92 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 171
72389931   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
72389927   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
72389923   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
72389919   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
146093410  81 TAARFHRLVTGEGGIHDATGVKLDYLYTPLELIDRQHGYARFGDLLAYGVRL--EPLRQETFKVRHTSRGLLTMTSYGPN 158
154341371  81 TAAHFRRLVTGESGTHDATGVKLDYLHTSLELIDRKHGYVRFGDLLAYGVRL--EPLRQETFKVRHTSRGLLTMTSYGPH 158
157872085  81 TAARFHRLVTGEGGIHDATGVKLDYLYTPLELIDRQHGYARFGDLLAYGVRL--EPLRQETFKVRHTSRGLLTMTSYGPN 158
71418924  172 TSGSVFGITLGPSRSLDFKQVVFGKAVDDLTLLEKLESLPLDAVGHPLVAAVVTFCGALTGPKPSGRFVCTREVNGNTAG 251
71656129  172 TSGSVFGITLGPSRSLDFKQVVFGKAVDDLTLLEKLESLPLDAVGHPIVPAVVTFCGALTGPKPSGKFVCTREVDGNTVG 251
72389935  172 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQVPAAADDSASS 251
72389931  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQLLAAADDSASS 195
72389927  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQLLAAADDSASS 195
72389923  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVDRPVLPVTVSFCGALTGEKPPGRQQVPAAADDSASS 195
72389919  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQLLAAADDSASS 195
146093410 159 LCNTSFAITLAAAPSLDFKQVAFGKVVDGLHLLEKLESLPLDQVGRPLTPVMIAICGTLTGERPPGKWA--SPQDRTGCD 236
154341371 159 LCNTSFSITLAAAPSLDFKQVVFGKVVDGLPLLEKLESLPLDQVGRPLTPVMIALCGTLTGGRPPGKWA--SSQDRTACK 236
157872085 159 LCNTSFSITLAAAPSLDFKQVAFGKVVDGLHLLEKLESLPLDQVGRPLTPVMIAICGTLTGERPPGKWA--SPQDRTGCD 236
71418924  252 DGAAAAAEE 260
71656129  252 DGAAAAAAE 260
72389935  252 EHVSCAGEE 260
72389931  196 EHVSCAGEE 204
72389927  196 EHVSCAGEE 204
72389923  196 EHVSCAGEE 204
72389919  196 EHVSCAGEE 204
146093410 237 EDLAYEAIQ 245
154341371 237 EDLAYEALE 245
157872085 237 EDLAYEAIE 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap