Conserved Protein Domain Family
PTZ00220

?
PTZ00220: PTZ00220 
Activator of HSP-90 ATPase; Provisional
Statistics
?
PSSM-Id: 173484
View PSSM: PTZ00220
Aligned: 6 rows
Threshold Bit Score: 249.35
Threshold Setting Gi: 66356446
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66356446    1 FRVPPRVLYNSFLDESDLTRLSLGSKCLMDPKEGGKFSLYNGSVEGTNISLDKDTRIEQNWRFSSWEEGVYSKVVIEFRP 80 
124504833   9 YYVPPEVLFNAFTDAYTLTRLSRGSLAEVDLKVGGKFSLFSGSILGEFTEITKPHKIVEKWKFRDWNECDYSTVTVEFIS 88 
156094135   9 YYVPPEVLFNAFTDAYTLTRLSRGSPAETDAKVGGKFSLFAGSVYGEFVEIEKPKKIFQKWRFRDWCEDDYSTVTLEFRA 88 
209878882  10 FRVPPSILYQSMLDERELTRLALGSPCKMDASIGGKFSLYNNYVEGEIEYLEPSRKIVQKWRCNSWKPDVYSKVTIEFLD 89 
237835187  11 FAVPAHVLYEAFLDPHQMMRVGLGAPAEIDPKVGGRFSWFNKSIEGEITALTPNKEIQEKWRFAEWEPMVYSDVKMKFDA 90 
221055645   9 YYVPPEVLFNAFTDAYTLTRLSRGSPAQTDAKVGGSFSLFAGSVYGEFMEIEKPHKIIQKWKFRDWCDKDYSKVTLEFRK 88 
66356446   81 LigEDDCTEVVLVQTGIPSLDKFGNPGCLEQCMLGWERNFWDRFEKIMGYPKFK 134
124504833  89 V--KENHTKLKLTHNNIPASNKYNEGGVLERCKNGWTQNFLHNIEVILGYPKKK 140
156094135  89 V--KENHTLLKLTQESIPSKNKFDEGGVLERCRNGWTENLLHNIEVILGYPKKK 140
209878882  90 IigETDCTEIVLKQTSIPSLDKFGNPGCSDQCLIGWESNFWDRFEKVLGYPRLK 143
237835187  91 E--ESDTTRLTIEQSGIPLTDKFGNGNCDVRVREGWRQHILDRFEKVLGYPRQK 142
221055645  89 V--KENHTLLKLTQENIPTKNKFDEGGVLERCRNGWTENLLHNIEVILGYPKKK 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap