Conserved Protein Domain Family
PTZ00214

?
PTZ00214: PTZ00214 
high cysteine membrane protein Group 4; Provisional
Statistics
?
PSSM-Id: 173479
View PSSM: PTZ00214
Aligned: 5 rows
Threshold Bit Score: 1221.31
Threshold Setting Gi: 159109323
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159108404   1 MLGLLPLALLASLCKSSRDVYYNKFGVGCDGKQENCAQDRCILLGSDQLCTQCVPGYVPIDGKCQKYPGASSSPCTPDDP 80 
159112766   1 MLGLLPLALLASLCKSSRDVYYNKFGVGCEGKQENCAQDRCILLGSDQLCTQCVPGYVPIDGKCQKYPGASSPPCTPDDP 80 
159109323   1 MLGLPALLLLASSCGASTYTYHNNFGVECNKHRDSCAQNRCVFMGWEELCTQCVSGYVPINGKCQLL--DDSSTCVPDDT 78 
159118927   1 MLKLLLLFFVGSFCGLPTGTYCNGFGIECGQGHEHCFSGRCLLIGSTKVCTRCVSGYVPINGVCQPYPGSASSVCIPEEA 80 
159118180   1 MLGLLSVLLFASFCEAAAEIYYNSFGVACKNNQNNCAQNRCIFVGRDELCTQCVSGYVPINGTCQLL--DASSVCIPDDA 78 
159108404  81 ASPTRCIACKQETNIFLFYGSCYTITTAqdrNLGNFLCSEASNGVCTECFESKFERYVFTNPDVGAVEKCILCSDTVGFN 160
159112766  81 ASPTRCIACKQETNIFLFYGSCYKITTTqdrNLGNFLCSEASNGVCTECYKNNTEMYVFTNPDTSAAEKCILCSDTVGFN 160
159109323  79 SSPTRCVECKSEQNVFLFYGGCYTIDQS---TIGSEICRQATSSRCTECNVSTTEKYVFTNPDTSAAERCILCSDTVGFG 155
159118927  81 ESSIRCIKCKPNENVFLFYGGCYTVDRS---AVGGQICSRASNGRCVECNVSTHGAYVFTNPNETAEERCIACSDSIGFS 157
159118180  79 SSPTRCVECKSEQNVFLFYGGCYTIDQS---TVGSDICCQATGGKCTECNVQTIKKYVFTNPDVGAAEKCILCSDTVGFN 155
159108404 161 GYKGASGCSDCLPPITDKIGIALCVRCHYTTEDRHFYPIDYQCQAKGPHNCVNGYCTSCYKTHLLYKLGCYSRHSSTGLA 240
159112766 161 GYKGASGCLDCLPPITDKIGIALCVKCHYTDKDRHFYPIDYQCQAKGPHNCVNGYCTSCYKTHLFYEYGCYSRHSSTGFA 240
159109323 156 GYRGASDCLYCIQPIKGEIGTALCTKCSYTKQNNGIGPVDYQCQAKGLHNCVNGYCTSCYKTHLFYEYGCYSRHSSTGFA 235
159118927 158 GYGGVLECYSCTQPVTGGKTTALCTKCRSPEQN----PIDHECRAKGLHTCFSGLCVSCYKTHLLYHSGCYSRGSDTGLA 233
159118180 156 GYKGASGCLDCLPPITDKVGIALCFECN----PRSLYPIDYQCQAKGLHNCINGYCTSCHKTHLFYEYGCYSRHSSTGFA 231
159108404 241 ICVEANQYELDNVTICKECANASYAPRNGACILIKENPSIEEIAFKCTKDPTKGLYTACPASAKSFLFYGGCYDEDAHIS 320
159112766 241 ICVEANQYELDNVTICKECANASYAPRNGACILIKENPSIEEIAFKCTKDPTKGLCTACPASAKSFLFYGGCYDEDAHIS 320
159109323 236 ICAEANQYELDNVTICTECVNTSHAPKNGGCTLVGESAS-RSLFSDCTKDASRGLCTDCSSTGKSFLFYGGCYNRDSHVG 314
159118927 234 ICAAKNQYVLDNVTICKECVNTLYAPKSGVCVPVDGDIPVMG-FSDCTKDNDKGLCINCANSAEYFLFYGGCYYKKSGIG 312
159118180 232 ICAGANQYELDNVTICTECVNTSHAPKNGGCTFVGESAS-GSLFSDCTKDASRGLCTGCSSTGKSFLFYGGCYDRNSFIG 310
159108404 321 SRLCSRIGSNACEQWNSAFKWIFSKNGDNNKNGYLCGDITNGGISGCATCNYASGAVTCTRCSAGYLGVDGKSCSESCSG 400
159112766 321 SRLCSRIGSNACEQWNSAFKWIFSKNGDNNKNGYLCGDIANGGISGCATCNYASGAVTCTRCSAGCLGVDGKSCSEGCSG 400
159109323 315 SKLCLEAAGGVCKQWRSNFNFTFSKAE--GGDRYLCGD-TSSGVRGCATCGYNNG-VTCTRCSTGYLGVDGRSCSEGCSG 390
159118927 313 SRLCSAVVSGVCTEWKTQFDFIFNKND--NDGGYLCGDATNGGVSDCATCSYESGAVTCTSCSKGYLGVDGKSCSKSCSG 390
159118180 311 SRLCQKIDQGKCTQWSSTFDFIFPKTDTSSGDRYLCGDAGNNGVRGCATCGYNNG-VTCTRCSAGYLGVDGKSCSESCSG 389
159108404 401 DTQGACTEIVEKSSSTKIlSCRCICRMGLYNSSGTCTPCTDSCAVCKDGTLTGCQQCSPGKILSFSIASSESADCVSQCS 480
159112766 401 DTRGVCTKVAEGSESTEV-SCRCVCKPTFYNSSGTCISCTDSCAVCKDGTLTGCQQCSPGKILNFSIVSSESADCINQCS 479
159109323 391 DTQGVCTKVAEGSESTEV-SCRCVCKPTFYNSSGTCTPCTDSCAVCKDGTPTGCQQCSPGKILESLVVADDNAKCVDECA 469
159118927 391 DTRGVCTKVTEGSESIET-SCRCVCMPTFYSSSGTCTPCTDSCAVCKDGTPDGCQICKPGKVLEPSVVTNGNAKCVDECT 469
159118180 390 DTRGACTEIVEKSSSTKIlSCRCVCRPTFYNSSGTCTPCTNSCAVCKDGTPTGCQQCSPGKILNFSIASSESADCVSQCS 469
159108404 481 VGSECAECGITIDGSRYCTRCKDASTYPFNGVCILNTQRDAYCTSKANGVCTTCSSSAFLMNGGCYTKAHYPGSTICDKQ 560
159112766 480 VSSECAECGITIDGSRYCTRCKDASTYPFNGVCIPNTQRDAYCTSTANGACTTCSGAAFLMNGGCYTTEHYPGSTICDKQ 559
159109323 470 VGDDCAECGITIDGSRYCTRCKDSNMYPLNGVCIPNTQKDAYCTSTANGTCTTCSGAAFLMNGGCYTKAHYPGSTICDKQ 549
159118927 470 VGDNCAECGITIDGSRYCTRCKDSNMYPLNGVCIPNTQKDAYCTSKANGACTACSEAAFLMNGGCYTTEYYPGSTICDKQ 549
159118180 470 VGSECAECGITIDGSRYCTRCKDASTYPFNGVCIPNTQRDAYCTSTTNGACTTCSGAAFLMNGGCYTTVHYPGSTICGKQ 549
159108404 561 SNGKCTTTKKGYGISPDGKLLECDPTCLACTAPGPGRCTRCPSDKLLKRASGATTGSCVDPGACVDGYYADGDACLPCAT 640
159112766 560 SNGKCEKTKEGYGISDDGKLLECDPTCLACTAPGPGHCTRCPSGALLKRASGAATGSCVDPGACGDGYYAYGDACLPCAT 639
159109323 550 SGGKCTTTKEGYGISPDGKLLECDPTCLACTAPGPGRCTRCPSDKLLKKASGAATGGCVDPGACVDGYYAYGDACLPCAT 629
159118927 550 SNGKCTTTKKGYWISPDGKLLECDPTCLACTAPGPGRCTRCPSDKLLKRASGAATGSCVDPGACVDGYYADGDACLPCAT 629
159118180 550 SNGKCTTTKKGYWISDDGKLLECDPTCLGCTAPGPGRCTRCPSDKLLKRTSGATTGSCIDPNACGDGYYADGDACLPCAT 629
159108404 641 PGCKACGHASFCTECAGELFVSLDGQSCLEECTGDKVVGEVPGGVRRCWCERGFLPALDRSECVLPIECPPDMPSCAACN 720
159112766 640 PGCKTCGHASFCTECAGELFVSLDGQSCLGECTGDKVVGEVSGGVRRCWCERGFLPALDRSGCVLPTECPPDMPLCAACD 719
159109323 630 PGCKTCGHASFCTECAGELFVSLDGQSCLEECTGDKVVGEVSGGVRRCWCERGFLPALDRSGCVLPTECPSGMPSCAACD 709
159118927 630 PGCKTCGHASFCTECAGELFVSLDGQSCLEECTGDKVVGEVPGGVRRCWCERGFLPAPDKSGCVPAPECPPDMSWCASCD 709
159118180 630 PGCKTCGHTSFCTECAGELFVSLDGRSCLGECSGDKVVGEVSGGVRRCWCERGFLPALDRSGCVLPTECPPDMPLCAACD 709
159108404 721 ESGNCLSCVTSGHNVQVDQRTCAEGCGARASSNQGVCMCEFDAVLTKDICVSAKELAKKRTAAIAGGTVAGVIVIGSLVG 800
159112766 720 ESGRCLLCVTSGHNVQVDQRTCAEGCGARASSNQGLCMCELDAVLTKGVCVPAKELARKRTAAIAGGTVAGVAVIGVLVG 799
159109323 710 ESGRCLLCATSGHNVQVDQRTCAEGCGARASSNQGVCMCELDAVLTKGICAPVKTLTKKKLVAIAAGTTMAVLVVGVLVG 789
159118927 710 MSGRCLSCVTSGHNVQVDQRTCAEGCGARASSNQGVCMCETSTILDKGVCIPVNTLTGRKMVVVTASAASAVLVISALIG 789
159118180 710 ESGKCLLCAASNHNIQIDQRTCAEGCGARASSNQGLCMCELDAVLTKGVCVPAKELARKRTAAIAGGTVAGVVVIGVLVG 789
159108404 801 FLCW 804
159112766 800 FLCW 803
159109323 790 FLCW 793
159118927 790 FLCW 793
159118180 790 FLCW 793
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap