Conserved Protein Domain Family
PTZ00210

?
PTZ00210: PTZ00210 
UDP-GlcNAc-dependent glycosyltransferase; Provisional
Statistics
?
PSSM-Id: 140237
View PSSM: PTZ00210
Aligned: 8 rows
Threshold Bit Score: 715.131
Threshold Setting Gi: 72393489
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72388496   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80 
72388498   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80 
72388500   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHEVSTFLDENQAGVSQPIDEGEYLMFVPSNVAAVWKAQRF 80 
72388502   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHEVSTFLDENQAGVSQPIDEGEYLMFVPSNVAAVWKAQRF 80 
72388504   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80 
72388506   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80 
72393487   1 -------MRTRRRRSQVYAFTLAVLIAISCLVVCCDLFFLSVIHLPLEEEKASA--PINVDECLRLTAPSTVSIWQEREF 71 
72393489   1 MTQRKVYPPYSWRKPRASVLVLTTTFTMALIIIMWDIYHISEVHSNSSYDLLGT---FENDYYLTLTPPSTVSIWQEREF 77 
72388496  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
72388498  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
72388500  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLCLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
72388502  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLCLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
72388504  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
72388506  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
72393487  72 LVIVGIPSVDRDEWQKRRNLQRRTCWQYAGVATLENNFTGELLPLYLLAPHQLNGYEISESLRDEASRTNDVVMLPTNDV 151
72393489  78 LVIVGIPSVDRDEWQKRRNLQRRTCWQYAGVATLENNFTGELLPLYLLAPHQLNGYEISESLRDEASRTNDVVMLPTNDV 157
72388496 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
72388498 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
72388500 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
72388502 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
72388504 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALYMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
72388506 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
72393487 152 CSFSRRKIGEGGSWGVESELVMSRKTFLWLQFAVTAFPNVSYIVKGDDDVFVRVPQYLADLRVMPRNGLYMGRVYGATFF 231
72393489 158 CSLARRKIGEGGSWGVESELVMSRKTFLWLQFAVTAFPNVSYIVKGDDDVFVRVPQYLADLRVMPRNGLYMGRVYGATFF 237
72388496 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVDTKACR 320
72388498 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
72388500 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
72388502 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
72388504 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
72388506 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
72393487 232 WRSGGIPFAAGYFTTFSRDVAEAVASYRPLERLLKAPYSIWRMRQYLSMSVLHEDVMTALVLQDKIRYKGLIIVDAAPCH 311
72393489 238 WRSGGIPFAAGYFTTFSRDVAEAVASYRPLERLLKAPYSIWRMRQYLSMSVLHEDVMSALVLQDKIRYKGLIIANAAGCH 317
72388496 321 FHNAGPGSVRKYISNKSVVIHHVSEEHYNELFDIFPVGEGGDKPSAVRWLYPGSGTLPCFQH 382
72388498 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
72388500 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
72388502 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
72388504 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
72388506 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
72393487 312 FHNAGKKGIRASLIDEYVVVHHIKENDYEVLMNHFADIAVQPKPSKVMWRSENYAVMQCFAT 373
72393489 318 FHNKAKEDIREAVSNRSVVVHHIREEDYEVLMDHFSNISERPQPYGVRWLRNDRAMVLC--- 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap