Conserved Protein Domain Family
PTZ00209

?
PTZ00209: PTZ00209 
retrotransposon hot spot protein; Provisional
Statistics
?
PSSM-Id: 140236
View PSSM: PTZ00209
Aligned: 8 rows
Threshold Bit Score: 1414.79
Threshold Setting Gi: 72391062
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72391056   1 MIQNNGNMGNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391050   1 MIQNNGNMRNTQNVFNERFNRAQGEVQEQGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391052   1 MIQNNGNMRNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391054   1 MIQNNGNMRNTQNVFNERFNRAQGEVQEQGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391058   1 MIQNNGNMGNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391060   1 MIQNNGNMRNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391062   1 MIQNNGNMRNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391064   1 MIQNNGNMGNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKSREEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRP 80 
72391056  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSKMGWPSDRFQCSLISLYQRIGildNNVYIRREMMRVWYIIQRKL 160
72391050  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSKMGWPSDRFQCSLISLYGGNG---GHIYVRREMMRVWYIIQRKL 157
72391052  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSKICNPSCGFQCSLISLYGGNG---GHIYVRREMMRVWYIIQRKL 157
72391054  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSKMGWPSDRFQCSLISLYGGNG---GHIYVRREMMRVWYIIQRKL 157
72391058  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSKMGWPSATFQ---LGINDESGimdNNVYIRREMMRVWYIIQRKL 157
72391060  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSKMGWPSATFQ---LGINDESGimdNNVYIRREMMRVWYIIQQKL 157
72391062  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSKMGWPSATFQ---LGINDESGimdNNVYIRREMMRVWYIIQQKL 157
72391064  81 QHIWTEEEVDITPEHCEVDAELEERPTGLEIFVLTSMMGWPSDRFQGGLISLYQRIGildNNVYIRREMMRVWYIIQQKL 160
72391056 161 NAWWVEKTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVFFTGSKAYLIYNKKGNEEGRVVLYKREDVTN 240
72391050 158 NAWWVEKTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGNEEGRVVLHKREDVTN 237
72391052 158 NAWWVEKTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGNEEGRVVLYEREDVTN 237
72391054 158 NAWWVEKTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGNEEGRVVLHKREDVTN 237
72391058 158 NAWWVQKTESTPPTHIVIGIPGTGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGNEEGRVVLYKRKDVTN 237
72391060 158 NAWWVQKTER-PPTHIVIGIPGTGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDAKAYLIYNKKGNEEGRVVLYKRKDVTN 236
72391062 158 KEWWVQKTESTPPTHIIIGIPGTGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDAKAYLIYNKKGNEEGRVVLYKRKDVTN 237
72391064 161 NAWWVQKTER-PPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDAKAYLIYNKKGNEEGRVVLYKRKDVTN 239
72391056 241 VIKEMRLKKRGHIIFDINSRKETLPYEIPRNVWGVTVLAPPDGVSYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLF 320
72391050 238 VIEEMRLKKRGHIIFDINSRKETLPYEIPRNVWGVTVLAPPDGVRYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLF 317
72391052 238 VIEEMRLKKRGHIIFDINSPKETLPYEIPRNVWGVTVLAPPDGVRYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSVF 317
72391054 238 VIEEMRLKKRGHIIFDINSRKETLPYEIPRNVWGVTVLAPPDGVRYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLF 317
72391058 238 VIKEMRLKKRGHIIFDTDGPDETPPYETQYLGWGITTLNTPDTYYYKHWEKDYFSWNVILNCDDVRDIKAFVAWKKLSLF 317
72391060 237 VIEEMRFKKRGHIIFDTDGPDETPPYETQYLGWGITTLNTPDTHYYEHWEKDYLSWNVILNCDDVRDIKAFVAWKKLSLF 316
72391062 238 VIKEMRLKKRGHIIFDTDGPDETPPYETQYLGWGITTLNTPDTHYYEHWEKDYLSWNVILNCDDVRDIKAFVAWKKLSLF 317
72391064 240 VIEEMRLKKRGHIIFDINSPKETLPYEIPRNVWGVTVLAPPDGVRYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLF 319
72391056 321 PNYTTLDENARLKVKEELEDEWRLVERRVDFVGPLPRYVFSNGA-GCREAAVIGYLSSLSCNRRDGYDMMMGKYFEWKGN 399
72391050 318 PNYTTLDENARLKVKEELEDEWRLVERRVDFVGPLPRYVFSNGA-GCREAAVIEYLSSLSCNRRDGYDMMMGKYFEWKGN 396
72391052 318 PNYTTLDENARLKVKEELEDEWRLVERRVDVVGPLPRYVFSNGA-CCREAAVIRYLSSLSCNRRDGYDMMMGKYFEWKGN 396
72391054 318 PNYTTLDENARLKVKEELEDEWRLVERRVDFVGPLPRYVFSNGA-GCREAAVIEYLSSLSCNRRDGYDMMMGKYFEWKGN 396
72391058 318 PNYTTLDENARAKVKEELEDEWRLVERRVDVVGPLPRYVFSKQSyTNRLQDISDYLRSLENEKKEEYETILEKYFTWKSE 397
72391060 317 PNYTTLDENARAKVKEELEDEWRLVERRVDVVGPLPRYVFSKQSyTNRLQDISDYLRSLENEKKEEYETILEKYFTWKSE 396
72391062 318 PNYTTLDENARAKVKEELEDEWRLVERRVDVVGPLPRYVFSKQSyTNRLQDISDYLRSLENEKKEEYETILEKYFTWKSE 397
72391064 320 PNYTTLDENARAKVKEELEDEWRLVERRVDVVGPLPRYVFGNRG-NCRELEVIRYLSRLSCNRRDGYDMMMGKYFEWKGN 398
72391056 400 HFTESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKVGAYSLKTRALVSLLFPRVFCV 479
72391050 397 HFTESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKVGAYSLKTRALVSLLFPRVFCV 476
72391052 397 HFTESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKVGAYSLKTRALVSLLFPRVFCV 476
72391054 397 HFTESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKVGAYSLKTRALVSLLFPRVFCV 476
72391058 398 KVVHSLVKIVREGGRYDDLESYHCRPLSVAIGNMILCTLFSTVATLMVEKHSESVYGKVGAYSLETRALVSLLFPRVFCV 477
72391060 397 KVVHSLVKIVREGSGYGNLESYHCRPLSVAIGNMILCTLFSTVATLMVEKHSESVYGKVGAYSLETRALVSLLFPRVFCV 476
72391062 398 KVVHSLVKIVREGGRYDDLESYHCRPLSVPIGNMILCTLFSTVATLMVEKHSESVYGKVGAYSLETRALVSLLFPRVFCV 477
72391064 399 DFTQPLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFATVAKSMSSLEFMMGYGKVGAYSLKTRALVSLLFPRVFCV 478
72391056 480 VTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKTGQNAIGNCKYKVLYRSLEESKLFVDGFFFVEDCSRRVADM 559
72391050 477 VTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPEAGQNAIGNCKYKVLYRSLEKSKLFVDGFFFVEDCSRRVADM 556
72391052 477 VTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPEAGQNAIGNCKYKVLYRSLEKSKLFVDGFFFVEDCSRRVADM 556
72391054 477 VTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKTGQNAIGNCKYKVLYRSLEESELFVDGFFFVEDCSRRVADM 556
72391058 478 VTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKTGQNAIGNCKYKVLYRSLEESKLFVDGFFFVEDCSRRVADM 557
72391060 477 VTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKTGQNAIGNCKYKVLYRSFEESKLFVDGFFFVEDCSRRVADM 556
72391062 478 VTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKTGQNAIGNCKYKVLYRSLEESKLFVDGFFFVEDCSRRVADM 557
72391064 479 VTKHLNYLRRLGETEDKRSILKDMTPQQFQLVEQKFLPEAGQNAIGNCEYKVLYRSFEESKPLVGGFFFVEDCSRRVADM 558
72391056 560 RDGFPQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 639
72391050 557 RDGFPQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 636
72391052 557 RDGFPQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 636
72391054 557 RDGFPQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 636
72391058 558 RDGFPQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 637
72391060 557 RDGFRQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 636
72391062 558 RDGFPQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 637
72391064 559 RDGFPQLGVASKTIVLIQITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNTA 638
72391056 640 DAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRKRGHE 693
72391050 637 DAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRKRGHE 690
72391052 637 DAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRKRGHE 690
72391054 637 DAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRK---- 686
72391058 638 DAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRKRGHE 691
72391060 637 DAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRKRGHE 690
72391062 638 DAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRK---- 687
72391064 639 DAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRK---- 688
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap